Details for Kale Locus Bo5g136830

Position : C5 ( 5`- 42501037 .. 42509340 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136830

Protein [Map View]
MAAANAPITMKEVLTLPSIGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQPLRRPITADSALMNPNSRIL
ALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVSFWKWITPKMLGLVTQTSVYHWSIEGDSEPVKMFDRTANLANNQII
NYKCSPNEKWLVLIGIAPGSPEKPQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFSKKQADLFFPPDFADDFPVAMQVSHKFYLVYVITKLGLLFVYDLETASAIYRNRISPDPIFLTS
EASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAES
PQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYMFLLQTILRTDPQGAVNFALMMSQMEGGCPVDY
NTITDLFLQRNLIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAILANGMFSHYDRPRVAQLCEKAGLYIQS
LKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDSCIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMDAKLPDARPLINVCDRFGFVPD
LTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLV
SEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWDKVLLEENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVLQNSAFSGNFNLQN
LLILTAIKADPSRVMDYINRLDNFDGPAVGDVAVDAQLYEEAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDS
VWSQVAKAQLRDGLVSDAIESFIRADDATHFLEVIRATEDANVYDDLVKYLLMVRQKVKEPKVDSELIYAYAKIERLGEI
EEFILMPNVANLQQVGDRLYDEALYEAAKIIYAFISNWGKLAVTLVKLQQFQGAVDAARKANSAKTWKEVCFACVDAEEF
RLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESGLGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIP
KLIRACDEQQHWQELTYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDIINDLLNVL
ALRLDHTRVVDIMRKAGQLRLIKPYMVAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDLHDSFDQIGLAQKIEKHELVE
MRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALEHA
WINNMLDFAFPYLLQFIREYSGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLALPAPPMPGMGGGPGMGGG
YGPPPQMGGMPGMPPMPPYGMPPMGGY*

DNA
ATGGCGGCAGCTAACGCCCCCATCACGATGAAGGAGGTCCTAACGCTTCCGAGCATTGGGATCAATCAGCAATTCATCAC
GTTTACGAATGTTACTATGGAGTCTGACAAGTACATATGTGTACGAGAGACGGCGCCTCAGAACAGCGTTGTGATTATTG
ATATGAATATGCCGATGCAGCCTCTAAGGAGACCTATTACTGCTGATTCTGCTCTTATGAACCCAAACTCGAGGATCCTT
GCCTTGAAAGCTCAAGTGCCAGGAACTACTCAGGACCATCTGCAGATATTTAACATCGAAGCAAAAGCAAAGTTGAAATC
ACATCAGATGCCTGAGCAGGTTTCTTTTTGGAAATGGATTACACCAAAGATGTTGGGGCTGGTTACACAAACTTCCGTGT
ATCATTGGTCGATTGAAGGTGATTCTGAGCCAGTTAAGATGTTTGATAGGACAGCCAATTTGGCAAACAATCAAATTATT
AACTATAAGTGCTCTCCTAATGAGAAGTGGTTGGTGTTGATTGGAATTGCCCCTGGCTCTCCTGAGAAACCACAATTGGT
AAAAGGGAATATGCAGCTTTTCTCTGTTGATCAACAGCGGAGTCAGGCCCTTGAAGCACATGCTGCTTCATTTGCCCAGT
TTAAGGTCCCTGGGAATGAGAATCCTTCTATTCTTATATCCTTTGCAAGCAAGAGCTTTAATGCTGGACAGATAACATCA
AAATTGCATGTCATTGAGCTTGGCGCTCAACCAGGAAAACCATCATTTTCAAAGAAGCAGGCAGATCTCTTCTTCCCCCC
AGATTTTGCTGATGATTTTCCTGTAGCCATGCAGGTCTCTCACAAATTTTACTTGGTATACGTCATCACCAAGCTTGGCC
TGTTGTTCGTATACGATTTAGAGACGGCTTCTGCCATCTACAGAAATAGGATAAGCCCAGACCCAATTTTCTTGACTTCT
GAAGCTTCTTCAGTTGGGGGTTTCTATGCCATTAATAGGCGAGGACAAGTTCTCCTGGCTACAGTAAATGAGGCTACGAT
AATACCTTTTATCAGCGGTCAATTGAACAATTTGGAACTTGCTGTCAATCTGGCTAAAAGAGGAAACCTCCCTGGTGCAG
AAAATCTGGTCGTCCAGCGGTTCCAAGAGTTATTTGCTCAAACGAAGTACAAGGAGGCTGCTGAGCTTGCTGCTGAATCT
CCTCAGGGGATTCTACGGACACCTGATACGGTGGCTAAATTCCAGAGTGTTCCAGTACAAGCAGGGCAAACTCCTCCATT
GTTACAGTATTTTGGGACCCTTTTGACTAGAGGGAAGCTCAATTCATATGAGTCTTTGGAACTATCTCGTCTTGTTGTGA
ATCAAAACAAGAAGAACCTCTTGGAAAACTGGTTGGCAGAGGATAAGTTAGAATGCAGTGAAGAACTTGGAGACCTTGTC
AAGACTGTAGATAATGACCTTGCTCTGAAAATATACATTAAAGCCCGAGCTACTCCGAAAGTTGTAGCAGCTTTTGCAGA
GCGAAGGGAGTTTGACAAAATACTGATTTACTCAAAGCAGGTTGGGTATACACCTGATTACATGTTTCTTTTGCAAACCA
TACTCCGTACGGATCCCCAGGGAGCAGTAAATTTTGCTTTAATGATGTCCCAAATGGAAGGAGGCTGTCCAGTTGACTAC
AATACCATCACTGATCTTTTCCTTCAGAGAAACCTGATCCGTGAAGCGACTGCTTTCCTTCTGGATGTTCTGAAGCCAAA
TTTACCTGAGCATGCTTTTCTGCAAACTAAGGTTCTGGAGATCAATTTGGTAACCTTTCCCAATGTGGCTGATGCAATTT
TAGCAAATGGGATGTTTAGCCACTATGACCGGCCTCGTGTTGCTCAGCTTTGTGAAAAGGCTGGACTTTATATCCAATCT
TTAAAGCATTACTCGGAGTTACCTGATATTAAACGTGTAATTGTGAACACACATGCTATTGAGCCCCAGGCTCTTGTCGA
GTTTTTTGGCACTCTTTCTAGCGAGTGGGCTATGGAGTGCATGAAGGATCTTTTGCTGGTCAACCTGAGAGGCAACCTTC
AGATAATAGTTCAGGCTTGCAAGGAGTACTGCGAGCAACTTGGTGTTGATTCATGCATTAAACTCTTTGAGCAGTTCAAG
TCTTATGAAGGGCTCTACTTTTTCCTAGGTTCATATTTGAGTATGAGTGAGGATCCTGAAATTCACTTCAAGTACATTGA
AGCAGCTGCCAAGACGGGTCAAATTAAGGAAGTTGAGCGTGTAACTAGAGAGTCTAACTTTTATGATGCTGAAAAGACGA
AGAACTTTTTGATGGATGCTAAGCTTCCTGATGCCAGACCTTTGATAAATGTCTGCGACCGTTTTGGCTTTGTGCCTGAT
CTTACTCATTACCTGTACACAAACAACATGCTTCGTTACATCGAAGGTTACGTGCAGAAGGTGAACCCTGGGAATGCTCC
CCTGGTTGTGGGGCAGTTGCTTGATGACGAATGCCCAGAAGATTTCATAAAAGGCCTCATTCTTTCTGTTCGTTCATTGC
TTCCTGTTGAGCCCCTTGTCGACGAATGCGAGAAAAGAAATCGACTCCGTCTCCTCACTCAGTTCTTGGAGCATCTAGTT
AGTGAGGGAAGCCAAGATGTGCATGTCCATAATGCCTTGGGTAAAATTATCATAGACAGTAATAACAACCCTGAGCATTT
CCTGACCACCAACCCTTACTACGACTCTAAGGTTGTGGGTAAGTACTGTGAAAAACGTGATCCCACCCTGGCTGTTGTGG
CATACAGAAGAGGACAATGTGATGAGGAGCTCATCAATGTCACCAACAAGAACTCTTTGTTCAAGTTACAAGCCAGGTAT
GTAGTGGAGAGGATGGATGGTGACCTCTGGGATAAGGTTCTTTTGGAAGAAAATGAGTATAGAAGACAACTTATTGACCA
AGTTGTGTCTACTGCTTTACCTGAAAGCAAGAGCCCAGAGCAAGTTTCTGCAGCTGTTAAAGCATTCATGACTGCTGATC
TGCCACACGAGCTTATCGAGCTTCTTGAAAAGATTGTGCTTCAAAATTCTGCCTTCAGCGGAAACTTCAATCTGCAAAAT
CTGCTTATACTGACAGCTATCAAGGCAGATCCGTCTAGAGTTATGGATTACATTAACAGGCTGGATAACTTTGATGGTCC
GGCTGTTGGAGATGTGGCGGTTGATGCCCAATTGTATGAAGAAGCGTTTGCAATTTTTAAGAAGTTTAACTTAAATGTTC
AGGCTGTCAATGTATTGCTGGACAACGTCAGAAGCATTGAGCGTGCTGTTGAGTTTGCTTTCCGGGTCGAAGAAGATTCT
GTTTGGAGCCAAGTCGCCAAAGCTCAACTCAGGGATGGGCTAGTCAGTGATGCAATTGAGTCTTTTATTCGAGCTGATGA
TGCCACTCATTTCTTGGAGGTCATACGTGCTACTGAAGATGCTAATGTCTATGATGACTTGGTCAAATACCTTCTTATGG
TTAGACAGAAGGTGAAGGAACCCAAGGTTGATAGTGAACTCATATATGCTTATGCAAAGATTGAAAGGTTGGGTGAGATA
GAGGAGTTTATTCTGATGCCGAACGTTGCTAACCTACAACAAGTGGGCGATCGCCTTTATGATGAAGCTTTGTATGAGGC
TGCAAAAATAATCTATGCGTTCATATCGAACTGGGGCAAGTTAGCCGTCACACTTGTGAAGTTGCAGCAGTTCCAAGGTG
CTGTTGATGCTGCGAGGAAAGCGAACAGTGCAAAGACATGGAAGGAAGTCTGCTTTGCTTGTGTTGATGCAGAAGAATTC
CGGTTGGCTCAAATATGTGGACTTAACATCATCATACAGGTGGATGACCTGGAAGAAGTCAGCGAGTACTACCAGAACAG
AGGATGCTTCAATGAATTAATCTCACTTATGGAGAGTGGACTTGGTCTGGAACGGGCTCACATGGGGATCTTCACCGAGT
TGGGTGTACTGTACGCCAGATATCGTTATGAGAAGCTTATGGAACACATCAAGTTGTTCTCGACTCGTCTCAATATTCCC
AAGCTTATACGAGCCTGTGATGAGCAACAGCATTGGCAGGAACTTACCTATCTTTACATTCAATACGATGAGTTTGATAA
TGCTGCAACTACTGTCATGAACCATTCTCCTGAAGCATGGGAGCACATGCAATTCAAAGACATTGTCGCCAAGGTTGCAA
ATGTCGAGCTTTACTACAAGGCCGTTCACTTCTACTTGCAAGAGCACCCTGATATAATCAACGATCTTCTCAATGTGCTT
GCTCTGCGGTTAGATCACACACGTGTGGTGGATATCATGCGCAAGGCTGGTCAGTTGCGCCTTATCAAGCCCTACATGGT
TGCAGTTCAGAGCAACAATGTTTCTGCTGTAAATGAAGCTCTGAATGAGATATACGTAGAAGAAGAAGACTACGATAGGT
TGCGTGAGTCTATTGATTTGCATGACAGCTTTGACCAGATAGGCCTCGCTCAGAAGATTGAGAAACACGAGCTTGTGGAG
ATGAGACGTGTGGCTGCGTATATCTACAAGAAAGCTGGTAGATGGAAGCAATCAATTGCGTTGTCGAAGAAAGATAATAT
GTACAAGGACTGTATGGAAACTGCTTCACAATCCGGCGACCATGACCTTGCAGAACAACTTCTGGTTTACTTCATTGAAC
AGGGGAAGAAGGAATGCTTTGCTACATGTCTCTTTGTCTGTTATGACTTAATCCGACCAGATGTTGCTCTGGAACATGCT
TGGATCAACAATATGCTTGACTTTGCCTTCCCGTATCTCCTCCAGTTTATCCGAGAGTACTCTGGCAAAGTGGACGAACT
AATCAAGGACAAGCTAGAGGCACAGAAAGAAGTGAAAGCCAAAGAGCAGGAAGAGAAGGATGTCATGTCCCAACAGAACA
TGTACGCCCAACTATTGCCACTGGCTCTACCTGCCCCACCGATGCCAGGAATGGGAGGAGGTCCAGGGATGGGAGGCGGT
TACGGTCCGCCACCACAGATGGGAGGAATGCCTGGAATGCCTCCAATGCCACCATATGGAATGCCACCGATGGGCGGCTA
CTAA