Details for Kale Locus Bo5g136760

Position : C5 ( 5`- 42456984 .. 42459665 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136760

Protein [Map View]
MNNQDKIMIEKETTDKIEIKTKNGLNEQEQEVKMDNMSDLDKTTNGLGEKWPEPIIRVQSLAESNLATVPDRFIKPPSQR
PNETITINQQPEDGAINIPVIDLSSILSGNQKDKERISEACREFGFFQVINHGVRPELMAAAREAWRSFFHLPVEAKEAY
SNSPSTYEGYGSRLGVEKGALLDWNDYYFLNFLPLALKDLNKWPSLPSNIREVVDEYGEELVKLGERLMRILSSNLGVNE
EQLQEAFGGEDFSACMRVNYYPKCPRPELALGLSPHSDPGGITILLPDDQVAGLQVHHGDTWITVNALPNAFVVNLGDQM
QILSNSIYKSSEHRVIVNSQKERVSLAFFYNPKSDIRIQPLEQLISSTNPPLYPPLSYDEYRLFIRTHGPRGKSYVESHV
SLVNG*

DNA
ATGAACAACCAAGACAAAATCATGATCGAGAAGGAGACCACCGACAAGATCGAGATCAAGACCAAGAACGGCCTCAACGA
ACAAGAACAGGAAGTCAAGATGGACAACATGAGCGACCTAGACAAAACCACGAATGGCCTCGGCGAAAAATGGCCAGAAC
CAATCATCCGGGTGCAGTCCCTGGCCGAGAGCAACCTCGCCACCGTCCCCGACCGTTTCATCAAGCCGCCATCTCAACGC
CCTAATGAAACCATCACTATTAATCAACAACCGGAAGATGGCGCCATAAATATCCCAGTCATAGACCTAAGCAGCATCTT
ATCCGGCAATCAAAAGGACAAGGAGAGGATCTCGGAAGCATGCCGTGAGTTTGGCTTCTTTCAGGTGATCAACCATGGGG
TGAGGCCGGAGCTGATGGCCGCCGCTAGAGAAGCTTGGAGAAGCTTCTTCCATTTGCCTGTAGAAGCCAAAGAAGCTTAC
TCAAACTCCCCAAGTACCTATGAAGGTTACGGAAGCAGATTGGGCGTGGAAAAAGGAGCACTTCTTGATTGGAATGATTA
TTACTTTCTCAATTTTCTTCCGCTTGCCTTGAAGGATCTCAACAAATGGCCTTCTTTACCATCAAACATTAGAGAAGTGG
TGGACGAGTACGGTGAAGAACTAGTGAAGCTAGGCGAGAGACTTATGAGAATATTATCGTCAAACTTGGGAGTAAATGAA
GAACAACTTCAAGAAGCATTTGGTGGAGAAGACTTTAGTGCATGCATGAGGGTTAACTATTACCCGAAATGCCCTCGACC
AGAGCTTGCCCTCGGCCTCTCTCCTCATTCAGATCCCGGCGGCATTACCATCCTCTTGCCGGATGATCAAGTCGCCGGCC
TTCAAGTCCATCACGGTGACACGTGGATTACCGTCAATGCTCTCCCCAACGCCTTTGTCGTCAATCTAGGCGATCAAATG
CAGATACTAAGCAATTCGATATACAAGAGTTCGGAGCATCGTGTGATAGTTAACTCGCAGAAAGAAAGGGTTTCACTTGC
ATTCTTCTATAACCCTAAGAGTGACATTCGTATCCAGCCACTGGAACAACTTATCAGCTCTACAAATCCTCCTTTATATC
CTCCCTTGTCCTATGATGAATACAGACTCTTCATTCGAACTCACGGTCCACGTGGCAAATCCTATGTTGAGTCTCATGTA
TCCCTCGTTAATGGATAA