Details for Kale Locus Bo5g136740

Position : C5 ( 5`- 42439612 .. 42441649 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136740

Protein [Map View]
MVGPSRPQIVLFGSSIVQMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDQVFPKDAEVQPSLVVVYFGGND
SMAPHPSGLGPHVPLSEYVDNMKKIAIHLQSLSDTTRIIFLSCPPVDEAKLRQNQSPYLSEVIRTNELCKTYSDACVELC
QELGLEVVDLFSTLQKADDWETVCFTDGIHLSAQGSKLVAAEILRVIKEAEWTPSLHWKSMPTEFSEDSPYDLVSADGKN
TVNSSEWTYFWEEQWD*

DNA
ATGGTAGGACCGTCGCGGCCTCAGATCGTTCTGTTTGGATCATCCATCGTCCAGATGAGCTTCGGCCATGGAGGTTGGGG
CGCCATTCTCTCCGAGGTCTATGCTCGTAAGGCTGACATCATTCTGCGTGGATACTATGGATGGAACTCAACTCGTGCTT
TGGAAGTTGTGGACCAAGTCTTCCCCAAGGATGCTGAGGTACAACCTTCTCTGGTCGTTGTGTATTTTGGAGGAAACGAC
TCAATGGCGCCTCACCCTTCTGGTCTAGGACCTCACGTTCCACTTTCTGAATACGTTGATAACATGAAGAAGATCGCTAT
TCATCTTCAGAGCCTTTCAGACACAACTCGTATCATATTCCTTAGTTGCCCTCCAGTGGACGAGGCCAAACTTCGTCAGA
ACCAAAGCCCATACTTGAGCGAGGTGATCCGCACAAACGAGCTCTGCAAGACTTATTCAGACGCTTGCGTGGAGCTGTGC
CAAGAGCTCGGCTTAGAAGTAGTTGATCTCTTCTCTACTCTTCAGAAAGCCGATGACTGGGAAACCGTTTGCTTCACAGA
TGGGATTCATTTGTCAGCACAAGGAAGCAAACTGGTGGCTGCAGAGATACTGAGAGTGATCAAAGAAGCGGAGTGGACAC
CGTCGCTTCACTGGAAATCGATGCCAACTGAGTTCTCAGAGGACTCACCTTACGATCTTGTTTCAGCTGATGGCAAAAAC
ACTGTCAACTCTTCAGAGTGGACGTACTTCTGGGAAGAACAATGGGATTAA