Details for Kale Locus Bo5g136730

Position : C5 ( 5`- 42434115 .. 42436013 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136730

Protein [Map View]
MAAPNVRTSSFSRNISVVSSSPQIPGLKCGPNGTTFISTGIRDLDRILGGGYPLGSLVMVMEDPEAPHHMDLLRTFMSQG
LVNSQPLLYASPSKDPRGFLGTLPNPGSSKEDKPIAPDLDQGESLRIAWQYRKYMENQKSSIDDYSNDFDMRKPLERQFL
AGRPIDCVSLLDSSDLSVAQDHCATFLTKFPRNSSNIASIGRIAIQSFCSPLCEYSDKESEMLSFIRLLKSMLMVSNAVA
IVTFPPSMLSPSSSTRLQHMADTLLSVKAIPDGDKELEKLLTGYKDINGFLNIHKVARINTQVPVILEAKTFSMSLKKRR
FLALECLNQAPVDGSSGTSYGTSGSCSGSSKSGALDF*

DNA
ATGGCTGCACCCAACGTTCGTACAAGCAGCTTCTCTCGCAACATATCAGTTGTCTCCTCATCCCCTCAAATACCTGGTCT
CAAATGCGGTCCTAATGGCACTACTTTCATATCCACTGGGATTCGTGACCTCGACAGGATACTAGGTGGTGGGTATCCTT
TGGGAAGCTTAGTGATGGTGATGGAAGATCCTGAAGCACCGCATCATATGGATCTGTTAAGAACTTTCATGTCTCAGGGG
CTTGTTAACAGTCAACCACTTCTTTATGCTAGTCCTTCCAAAGATCCTAGAGGGTTTCTTGGTACTTTGCCGAATCCTGG
ATCGTCCAAAGAAGATAAGCCTATTGCCCCAGACCTTGATCAGGGAGAGAGCTTGAGGATTGCTTGGCAGTATCGGAAGT
ATATGGAAAACCAGAAGAGTTCTATTGATGATTACTCCAATGACTTTGATATGAGAAAGCCATTGGAGAGGCAGTTTCTT
GCTGGACGGCCGATAGATTGTGTCAGTCTGCTAGATTCTTCCGATCTTTCTGTTGCTCAGGACCACTGCGCTACTTTTTT
AACAAAATTTCCGAGGAACAGCAGTAACATTGCATCCATTGGCCGCATCGCCATCCAGTCATTCTGCTCTCCCCTTTGTG
AGTATTCTGATAAGGAATCAGAAATGCTTTCATTCATAAGATTGCTGAAAAGTATGCTGATGGTTTCAAATGCGGTTGCC
ATTGTTACTTTCCCGCCTTCCATGCTCTCCCCGTCTTCGTCAACAAGACTGCAGCACATGGCGGATACCTTACTCTCTGT
CAAAGCGATCCCAGATGGTGACAAGGAATTGGAGAAACTTCTCACTGGCTACAAGGACATAAATGGATTCCTCAACATAC
ACAAAGTTGCGCGTATCAATACACAGGTGCCTGTAATTCTAGAGGCAAAGACCTTCTCAATGAGCTTGAAGAAGAGAAGA
TTCTTGGCTCTAGAGTGTCTGAATCAAGCCCCTGTAGACGGATCCAGTGGAACATCGTATGGCACATCTGGGAGCTGCTC
TGGATCATCCAAATCCGGAGCACTCGATTTCTGA