Details for Kale Locus Bo5g136710

Position : C5 ( 5`- 42428808 .. 42431084 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136710

Protein [Map View]
MSSKASSSRGGESIVADCGRNTSTCGYCKSPTSSSISHGLWTERLTVHDYQALLDRGWRRSGCYLYKPEMAKTCCPSYTI
RLRANDFVPSKEQQRVRRRLERFLDGELDLKPREQTEDPDVEVSEPVRKLLGSGKREQNNEVEPIMKDLSEQIDNAVQRC
IQSGEFPSNIQIPKSSVKKVLSAKRKKLAEGSEELLYTSNIAFPIVAALKQTSQKGEGRNNAEENRLSPETVSEKLLSEI
KKVGEFPSLAIKVCKGHINFFSATQVTSSERDQGESLPSATTTTKSSSNNLQVRKKKLEIHLKRSSFDPEEYELYKRYQL
RVHNDEPESISKTSYKRFLVDTPLIEVLPSSDGDDDEEVPPCGFGSYHQQYRVDGRLIAVGVIDILPKCLSSKYLFWDPE
FASLSLGNYSALQEIDWVKQNQAHCSALEYYYLGYYIHSCNKMRYKAAYRPSELLCPLRFQWVPFEVAKPLLDKKPYSVL
SDFTKASLSPAPQASETLVKSTREREDMEMNNSDEDSDSDSGVNGNDIANILISLNGARLRYKDLLRIMNMRVRKQMESM
FISYRKVVGAELSERMVYELQ*

DNA
ATGTCGTCGAAGGCGAGTAGCAGCCGTGGTGGAGAGAGTATCGTCGCTGATTGTGGGCGCAATACATCCACTTGCGGCTA
CTGTAAATCCCCTACCAGCTCCAGCATCTCTCACGGTTTATGGACAGAGAGACTCACTGTTCATGATTACCAAGCTCTTC
TTGACCGTGGATGGAGACGGTCTGGCTGCTACCTTTACAAACCTGAGATGGCTAAAACTTGTTGCCCTTCTTACACTATC
CGCTTGAGAGCAAATGATTTTGTTCCCTCTAAGGAGCAGCAGCGAGTGCGTAGAAGACTAGAAAGGTTCTTGGACGGTGA
GCTAGATCTGAAGCCTAGAGAGCAAACAGAAGATCCAGATGTGGAAGTTTCAGAGCCGGTGAGAAAGTTACTTGGTTCTG
GTAAAAGAGAACAAAACAATGAAGTGGAACCAATCATGAAAGATTTGTCTGAACAAATTGATAACGCGGTACAAAGATGC
ATACAGAGCGGGGAGTTTCCTTCTAATATTCAGATTCCAAAATCTTCGGTGAAGAAAGTCCTCTCTGCCAAAAGGAAGAA
GCTAGCCGAAGGGTCAGAAGAGCTCTTGTACACCAGCAACATTGCTTTTCCAATTGTAGCTGCACTTAAACAAACATCTC
AGAAAGGCGAGGGAAGAAACAATGCAGAAGAAAACAGATTATCACCAGAGACTGTTTCTGAGAAGTTGTTAAGTGAAATA
AAGAAAGTAGGAGAGTTCCCTAGCTTGGCTATCAAAGTCTGCAAAGGCCATATCAACTTCTTTTCAGCTACACAAGTCAC
TTCCTCAGAGAGAGATCAAGGTGAAAGCCTCCCCTCTGCTACAACAACTACAAAGTCTTCTTCAAACAACCTTCAGGTAA
GAAAGAAGAAGCTGGAGATACATTTGAAAAGGTCAAGTTTTGATCCAGAGGAGTATGAACTATACAAACGTTATCAACTG
AGAGTTCATAACGATGAGCCAGAAAGCATCTCAAAAACTTCGTACAAAAGGTTTTTGGTTGACACTCCGTTGATCGAAGT
TCTCCCTTCAAGTGATGGTGATGATGATGAAGAGGTTCCTCCTTGTGGCTTTGGTTCTTACCATCAACAATACAGAGTTG
ACGGACGTCTTATAGCTGTGGGAGTAATCGACATTCTTCCCAAATGTTTGTCTAGTAAATACCTATTCTGGGATCCGGAA
TTTGCTTCCTTGTCTCTTGGAAACTACTCTGCTCTCCAAGAGATCGATTGGGTGAAACAGAACCAAGCTCATTGCTCTGC
GCTTGAGTATTACTATCTTGGCTATTACATACATTCTTGCAACAAGATGAGATATAAAGCGGCGTATCGTCCTTCCGAGC
TTCTATGTCCTCTCCGTTTCCAATGGGTTCCATTTGAAGTAGCTAAGCCTCTACTTGACAAAAAGCCGTATTCTGTGTTG
TCTGATTTCACTAAAGCTTCTTTATCACCTGCACCTCAAGCTTCTGAAACACTAGTGAAGTCCACGAGGGAACGGGAAGA
CATGGAGATGAACAACTCTGATGAAGACTCAGATTCTGATTCTGGTGTTAACGGCAATGACATTGCCAATATACTTATCA
GTCTTAATGGAGCTAGGCTTCGATACAAGGATTTATTACGGATCATGAACATGAGAGTTCGTAAACAAATGGAATCGATG
TTTATCAGTTACCGGAAAGTTGTGGGAGCTGAGCTTTCGGAGAGAATGGTGTATGAACTACAGTAA