Details for Kale Locus Bo5g136700

Position : C5 ( 5`- 42415479 .. 42416210 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136700

Protein [Map View]
MSFPLKVRSVRGNNGGGGGTGTKCGRWNPTVEQLKILTDLFRAGLRTPTTDQIQKISTELSFYGKIESKNVFYWFQNHKA
RERQKRRKISIDFDHHHQENDYISHHHHHRQPSTRDVFEINEDEEERVIETLQLFPVNSFQESKVDKMRSRVNNQYRDYI
RETNTTTFPSYSSCGAEMEHPSPLELRLSFL*

DNA
ATGTCTTTCCCCCTGAAAGTTCGTAGCGTACGTGGCAACAACGGAGGAGGAGGAGGGACGGGGACGAAGTGCGGGAGGTG
GAACCCGACGGTGGAGCAGTTGAAGATATTGACTGACTTGTTCCGAGCTGGTCTTAGAACTCCGACCACTGACCAAATTC
AGAAGATCTCTACAGAGCTCAGTTTCTACGGCAAGATCGAGAGTAAGAATGTTTTCTATTGGTTCCAAAACCATAAGGCT
AGAGAGAGGCAAAAACGCCGTAAAATCTCCATTGATTTTGATCATCATCATCAAGAAAATGACTATATCTCTCATCATCA
TCATCATCGTCAACCATCAACTAGAGATGTTTTTGAAATAAACGAAGACGAGGAGGAGAGGGTAATAGAGACGCTACAAC
TCTTTCCGGTGAATTCATTCCAAGAATCCAAAGTGGACAAAATGAGAAGCAGAGTCAATAACCAGTACCGTGACTACATA
CGAGAGACCAACACGACCACGTTTCCTTCGTACTCATCATGTGGAGCTGAGATGGAACATCCATCGCCGTTGGAACTTCG
ATTAAGCTTTCTTTAA