Details for Kale Locus Bo5g136680

Position : C5 ( 5`- 42405442 .. 42406330 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136680

Protein [Map View]
METLKPLSHVPISDYRFVGQDMMSLQSPSSIWTKEENKMFERALAIYPEDSPDRWFKIASMIPGKTVFDVMKQYNKLEED
VFDIEEGRVPIPGYPSPLGFAQDTCRKRPNGARGSDHDRKKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQ
VASHAQKYYQRQLSGAKDKRRPSIHDITTGNLLNANLNRSFSDHRDILLDLGFIENDNAEEGLMCMSQNPFCPSSAPFDA
AFNFAGVNAYSDGA*

DNA
ATGGAGACTCTGAAACCACTCTCTCACGTGCCTATCTCTGATTACCGGTTTGTTGGTCAAGATATGATGAGCTTACAAAG
CCCTAGCAGCATCTGGACTAAAGAAGAGAACAAGATGTTTGAACGAGCCCTTGCCATCTACCCTGAAGACTCCCCCGATC
GCTGGTTCAAGATTGCTTCCATGATCCCTGGAAAGACTGTTTTTGATGTTATGAAGCAATACAATAAGCTCGAAGAAGAC
GTTTTCGATATTGAAGAAGGACGTGTCCCCATTCCTGGTTACCCTTCTCCCTTGGGGTTTGCACAAGACACTTGTCGAAA
GCGACCTAATGGAGCTAGAGGATCTGATCACGATCGAAAGAAAGGAGTCCCTTGGACAGAGGAAGAACACAGGAGATTTT
TGCTCGGGCTTCTCAAGTACGGGAAAGGAGATTGGAGAAACATATCGAGAAACTTTGTCGTGTCTAAGACTCCAACGCAA
GTGGCAAGCCATGCCCAAAAGTATTACCAGAGACAACTCTCTGGAGCAAAGGATAAGCGCCGGCCAAGCATCCATGACAT
CACAACCGGCAATCTTCTAAATGCCAATCTCAACCGTTCCTTTTCTGATCATAGAGATATCCTCCTGGATTTAGGGTTTA
TCGAAAATGATAATGCTGAGGAGGGACTAATGTGTATGAGTCAGAATCCTTTTTGTCCATCATCAGCTCCCTTTGATGCT
GCCTTTAACTTTGCTGGAGTAAATGCATATAGTGACGGAGCGTAA