Details for Kale Locus Bo5g136650

Position : C5 ( 5`- 42389682 .. 42391987 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136650

Protein [Map View]
MAADPNPNKFPVLSYVLSRLPSFTATKSSSPSSSSSAPAFDVEQPIEIVTQMPHLGHPSVLASMTKAISDVAQTRSILRT
LGPRPDHESVDKARAKLSEIEGILSESISDIAINDAASAEGKDEDEEKKKEEMGKDKTVCESILKLDEVHDSYEKMLKEA
EERLVRIYESEVVGGEDGVAAAVEVNEEVVGILQHALDNRVERVDLSGRKLRLLPEAFGRIQGLLVLDLSNNQLQAIPDS
IAGLHDLVELNVSGNILETLPDSIGLLSKLKILNVSTNKLTVLPDSICRCGSLVILDVSFNRLTYLPTNIGSELVNLEKL
MIQYNKIRSFPSSIGEMISLTYLDAHFNELHGLPDSFCLLANLEYLNLSSNFSDLIELPISFGDLINLQELDLSNNQIHA
LPDTFGSLESLTKLNVSQNPLVVPPEEVVKEGAEAVKMYMGKRRISMFEEEEKRKMEEEMEQANAGWLTRTTSKLKTYVT
DVSEYLGSGSPRDSYLEQKL*

DNA
ATGGCGGCAGATCCTAACCCTAACAAGTTCCCCGTCCTCTCCTACGTCTTGTCTCGTCTCCCTTCCTTCACCGCCACCAA
ATCATCTTCCCCTTCCTCCTCCTCCTCCGCTCCCGCCTTCGATGTCGAGCAGCCGATCGAGATCGTCACCCAGATGCCTC
ACTTGGGGCATCCATCTGTCCTCGCCTCCATGACCAAAGCCATCTCCGACGTGGCCCAGACCCGATCCATCCTCCGCACC
CTCGGGCCCAGGCCCGATCACGAGTCCGTGGACAAGGCGCGCGCCAAGCTCTCGGAGATCGAGGGGATTCTATCCGAGTC
GATCAGCGACATCGCGATCAACGACGCTGCTTCGGCGGAGGGGAAGGACGAGGATGAGGAGAAGAAGAAGGAAGAGATGG
GGAAGGACAAGACTGTGTGCGAGTCGATTTTGAAATTGGACGAGGTTCATGATTCGTATGAGAAGATGTTGAAGGAAGCG
GAGGAGAGGCTGGTGAGGATTTATGAATCTGAGGTGGTGGGGGGTGAGGATGGCGTTGCGGCGGCGGTGGAGGTTAATGA
GGAGGTTGTTGGGATACTGCAGCACGCGTTGGATAATAGGGTGGAGCGTGTGGATTTGTCTGGGAGGAAGCTGAGGTTGC
TCCCTGAAGCGTTTGGGAGGATCCAAGGGTTGCTTGTTCTTGATCTCTCCAACAACCAGCTCCAGGCTATACCTGATTCA
ATAGCGGGACTGCATGATCTTGTTGAATTAAATGTCTCCGGGAATATTCTGGAGACTTTACCAGACTCTATCGGCCTCCT
GTCCAAACTGAAAATTCTGAATGTCTCGACTAACAAGCTCACCGTCTTGCCTGATTCCATCTGCCGTTGTGGGTCGTTGG
TTATCTTGGACGTGAGCTTCAACCGTCTCACCTACTTACCAACCAACATCGGGTCCGAGCTAGTGAATCTAGAGAAGCTA
ATGATCCAATACAACAAGATCCGATCCTTCCCGAGCAGCATAGGCGAAATGATATCCCTAACGTACCTCGACGCCCACTT
CAACGAACTCCACGGCCTTCCTGATTCTTTCTGTTTGCTCGCAAACCTCGAGTACTTAAACCTAAGCAGTAACTTCAGTG
ACCTCATTGAGCTCCCTATTTCATTCGGCGACCTCATAAATCTCCAAGAGCTCGACTTGAGCAACAACCAGATCCACGCC
CTCCCTGACACTTTCGGCTCACTGGAAAGCCTGACAAAGCTGAATGTGAGCCAGAACCCGCTCGTGGTGCCACCGGAGGA
AGTGGTGAAGGAAGGTGCGGAAGCGGTGAAGATGTATATGGGAAAGAGAAGGATAAGTATGTTTGAAGAAGAGGAGAAGA
GGAAAATGGAGGAGGAGATGGAGCAGGCAAACGCCGGGTGGCTCACGAGAACAACATCCAAGCTGAAAACGTATGTCACA
GATGTTTCAGAGTATCTGGGATCGGGTTCTCCTCGAGACTCTTACCTTGAGCAGAAGCTATGA