Details for Kale Locus Bo5g136610

Position : C5 ( 5`- 42360222 .. 42361653 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136610

Protein [Map View]
MTMDAQQKTSKFKWGEMDEDDDLDFLLPPKQVIGPDANGLKTVIEYKFNDQGKKVKITTKSRVRKLASARLNKRAMERRS
WPRFGDAANEDAGSNLTMVSTEEIVLERPRAPGTKAEESNGDSLSQLSKPGAVLMVCRTCHKKGDHWTSKCPYKDLAAPV
DVFVDKPPTGEPSAVSAAPGPGKASYVPPSMRPGADRSAAGSDMRRRNDENSVRVTNLSEDTREPDLMELFHPFGAVTRV
YVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWATPRPTQ*

DNA
ATGACGATGGATGCGCAGCAGAAAACGAGCAAGTTCAAATGGGGAGAGATGGACGAAGACGACGATCTCGATTTCCTCCT
CCCTCCGAAGCAGGTGATCGGCCCCGACGCAAACGGATTGAAGACGGTGATCGAGTACAAGTTCAACGACCAAGGCAAGA
AGGTCAAGATCACCACCAAGTCGCGCGTCCGTAAGCTTGCTTCCGCGAGGCTCAACAAACGCGCCATGGAGCGGAGGAGC
TGGCCTAGGTTCGGAGACGCAGCGAACGAGGACGCCGGTAGCAATCTCACCATGGTTTCCACCGAAGAGATCGTCTTGGA
ACGACCTAGGGCTCCTGGCACCAAAGCAGAAGAATCCAATGGAGACAGCTTGTCTCAGCTGAGCAAACCTGGTGCCGTCC
TCATGGTCTGCAGGACATGCCACAAGAAAGGTGATCACTGGACATCAAAGTGTCCTTACAAGGATCTAGCTGCACCAGTG
GATGTCTTTGTGGACAAGCCACCCACTGGGGAGCCATCTGCCGTATCCGCTGCACCTGGACCTGGCAAGGCCTCTTATGT
CCCGCCCAGCATGAGACCAGGTGCGGACAGAAGCGCTGCTGGTTCGGACATGAGGAGGAGGAACGATGAGAACTCTGTTC
GTGTCACTAACTTGTCTGAAGACACCCGTGAGCCTGATTTGATGGAGCTTTTCCATCCGTTTGGAGCTGTCACGCGTGTC
TACGTGGCGATTGATCAGAAAACTGGAGTGAGCAGAGGGTTTGGATTCGTTAATTTCGTGAGCAGAGAAGACGCTCAACG
AGCAATCAACAAGTTGAATGGTTATGGTTATGATAACCTCATCCTCAGGGTTGAGTGGGCTACTCCAAGACCCACCCAGT
AA