Details for Kale Locus Bo5g136600

Position : C5 ( 5`- 42354397 .. 42355689 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136600

Protein [Map View]
MAGICCGVVGESEPAVTVDSSTRASLRRRLDLLPSIKIVAPPLESSRKRQKRETPSGNQDLESNVRSERNVEKKARSSPV
KNSNLIPSSATEAESCFVSDAPKIGTTSVCGRRRDMEDAVSVHHSLIHKNSENLHFYGVFDGHGCSHVAEKCRERLHEIV
KRDVEAMAAGGEDEWKETMAKSFQKMDREVCQRDSNNGAASRSVKSSCRCELQSPQCDAVGSTAVVSVVTPEKIVVSNCG
DSRAVLCRNGVAIPLSSDHKPDRPDELIRIQQAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVIPDPEVAVTDRTDDDE
CLILASDGLWDVVTNETACGVARMCLQGAAAADGGDSDTAHNACSDAALLLTKLALARQSSDNVSVVVVDLRKRRSNNQV
S*

DNA
ATGGCTGGGATTTGCTGCGGTGTTGTTGGGGAGAGCGAACCGGCGGTTACGGTCGATTCGTCTACTCGAGCTTCTCTTAG
ACGGAGGTTAGATCTACTCCCTTCGATCAAAATAGTTGCTCCTCCGCTTGAGAGCTCACGTAAGCGGCAGAAACGTGAGA
CACCGTCGGGAAATCAAGATCTGGAATCGAATGTACGTAGCGAGAGGAACGTGGAGAAGAAGGCGCGATCATCACCGGTT
AAGAATTCAAATTTGATTCCGAGCTCCGCGACGGAAGCAGAGAGCTGTTTCGTCTCCGATGCGCCTAAGATCGGAACGAC
GTCGGTTTGCGGCAGGAGAAGAGACATGGAAGACGCCGTCTCGGTTCACCACTCGCTGATCCACAAAAACTCCGAGAATC
TCCACTTCTACGGCGTTTTCGACGGCCACGGCTGCTCTCACGTCGCGGAGAAGTGCAGGGAGCGTTTGCATGAGATTGTC
AAGCGGGACGTCGAAGCTATGGCCGCCGGAGGAGAGGACGAGTGGAAGGAGACGATGGCGAAGAGCTTCCAGAAGATGGA
TCGAGAAGTTTGCCAGCGAGACTCTAACAACGGTGCGGCGAGTCGGAGCGTGAAGAGCTCGTGCAGATGCGAATTGCAGT
CTCCTCAGTGCGACGCCGTCGGATCCACCGCCGTCGTGTCCGTAGTCACGCCGGAGAAGATCGTCGTCTCTAACTGCGGA
GACTCTCGCGCCGTGCTTTGCCGTAACGGAGTGGCCATCCCTCTCTCTTCGGATCATAAGCCGGATCGACCCGATGAATT
GATTCGGATCCAACAAGCGGGCGGGCGGGTTATCTACTGGGACGGCGCCAGGGTTCTAGGAGTTCTCGCTATGTCGAGAG
CTATTGGTGATAACTACTTAAAACCGTATGTGATTCCGGATCCGGAGGTAGCCGTAACGGATCGAACCGACGACGACGAG
TGCTTGATCTTAGCGAGTGATGGACTCTGGGACGTTGTGACGAACGAGACTGCGTGCGGCGTTGCTCGCATGTGCCTTCA
AGGTGCTGCTGCGGCGGATGGAGGAGACTCTGATACGGCGCACAACGCGTGTTCGGACGCTGCGTTGCTGTTGACGAAGC
TGGCTCTGGCGAGACAGAGCTCCGATAACGTTAGTGTCGTGGTGGTTGACTTGAGGAAAAGGAGGAGTAATAATCAAGTG
TCTTGA