Details for Kale Locus Bo5g136590

Position : C5 ( 5`- 42326028 .. 42328540 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136590

Protein [Map View]
MKLNRGGGEHGHHHHHHEALKFSSFFFMPERPREYLLLLTRFSVLTCLIVSISLVLRTTFLSSSAPEYSSSYGLRFPAVP
QKAIALPPTRSAGPVTISHVQFCIAGAAETWLDRSQYTSLWWRNTTRGFVWLDKPVKTPEIQSDNRFSIPVRVSDPGWTR
FRFSSSQAAVRIARVIWDSYRLNLPDVRWFVMGDDDTVFFPENLVKVLSKYDNEQMWYIGGNSESVEQDVMHAYDMAFGG
GGFAISRPLAARLASAMDGCLQRYFYFYGSDQRIAACVSEIGVPFTEERGFHQLDIRGDPYGFLAAHPLTPLVSLHHLVY
LNPMFPNKTPIESLQALMRPYTLDPHRILQQIHCYDRKRQWSISISWGYSIQIYTYFLTAKELDTPLQTFKTWRSSSDGP
FTFNTRPLKPDPCERPVTYFMDGAEDVRDSGTKTWYSVGDKKYGHCGKSEYSRVTKVKRILVTSMKMDPEYWNKAPRRPC
CEVMEGRGRRKEEEMSIRIRKCRSAEMI*

DNA
ATGAAACTGAATCGCGGCGGTGGAGAGCACGGCCACCACCACCACCACCACGAGGCCCTGAAGTTTTCCAGTTTCTTCTT
CATGCCGGAGCGGCCACGCGAGTATCTCCTGCTTCTCACACGCTTCTCCGTCCTCACGTGCCTCATCGTCTCCATCTCTC
TCGTTCTCCGCACCACCTTTTTATCCTCCTCCGCGCCGGAATATTCCTCCTCTTACGGTCTCCGATTCCCCGCCGTGCCA
CAGAAAGCCATAGCTCTCCCGCCGACAAGATCCGCCGGACCGGTTACCATCTCCCACGTCCAGTTCTGCATCGCCGGAGC
AGCGGAAACCTGGCTCGATCGGAGCCAATACACCTCCTTATGGTGGCGAAACACCACCCGCGGATTCGTCTGGCTCGATA
AACCGGTTAAGACCCCCGAAATCCAATCCGATAACCGGTTCTCGATCCCGGTTCGAGTTTCCGATCCAGGCTGGACCCGG
TTCAGATTCTCCAGCTCGCAAGCCGCGGTTCGGATCGCTCGCGTGATCTGGGATAGCTACCGTCTGAACCTCCCCGACGT
GAGGTGGTTCGTGATGGGAGACGACGACACCGTCTTCTTCCCCGAGAATCTCGTCAAGGTCCTCTCGAAGTACGACAACG
AGCAGATGTGGTATATCGGCGGGAACTCGGAGAGCGTCGAGCAGGACGTGATGCACGCGTACGACATGGCGTTCGGCGGC
GGCGGTTTCGCGATCAGCCGCCCGCTCGCGGCGCGTTTGGCGAGCGCGATGGACGGTTGTCTCCAGCGGTATTTCTACTT
CTACGGCTCGGATCAGAGGATCGCGGCTTGCGTTAGCGAGATCGGCGTTCCGTTCACCGAAGAACGCGGGTTTCACCAGC
TTGACATAAGAGGAGATCCATACGGGTTTCTAGCGGCGCATCCATTGACACCTCTTGTATCGCTGCATCACCTCGTTTAC
TTAAATCCGATGTTCCCTAACAAAACCCCCATCGAGTCTTTACAAGCCCTTATGAGACCCTACACGTTAGACCCGCATAG
AATACTACAACAGATTCATTGCTACGACCGCAAGCGTCAATGGTCCATATCCATCTCTTGGGGATACTCTATTCAGATAT
ACACGTACTTCTTGACCGCTAAGGAGCTGGATACGCCGTTGCAGACCTTCAAAACTTGGCGGTCTTCGAGCGATGGACCT
TTCACGTTTAACACACGGCCCTTGAAACCTGACCCTTGTGAGCGTCCAGTGACTTATTTCATGGATGGAGCAGAGGATGT
GCGGGATAGTGGGACGAAGACATGGTATAGCGTGGGGGATAAGAAGTATGGGCATTGCGGAAAGAGTGAGTATTCTCGGG
TGACCAAAGTGAAGAGGATATTGGTGACTTCTATGAAGATGGATCCTGAGTATTGGAACAAGGCACCACGAAGACCGTGT
TGCGAGGTAATGGAAGGAAGAGGAAGAAGAAAGGAGGAGGAAATGTCGATAAGAATTAGAAAGTGCAGATCTGCGGAGAT
GATATGA