Details for Kale Locus Bo5g136570

Position : C5 ( 5`- 42318222 .. 42319933 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136570

Protein [Map View]
MSYTAESDDDGMHSPAGDSIGGYGCKSRGKGSVLKKGPWTSTEDGILINYVRKHGEGNWNAVQKYTSLARCGKSCRLRWA
NHLRPNLKKGAFSQEEERLIVQMHAKMGNKWAQMAEHLPGRTDNEIKNYWNTRIKRRHRAGLPLYPPELHVEDLQLSEEY
TTSNVTRVNRRRHQDILQLGNSKADVLFDDLNFATNLLPGASDVLDMFTCNMLGTGASSSPYESYMPPILPSPKQLRESG
SLFPLCSSNIKQEFHSPEPFQNPRSCSISPCDVGHHSPYGNQRPSDVMISDSHAFMDGMLPTSKPLFGAVKLELPSFQYS
ETSGFDQWKTTTPSPPHSDPLDSVDAYIQSPPPLEIEDESNCFSSCDTGLLDMLLPNAKIKTSAKRSLALPEIPIPTQLS
AGETSADSAGNVVKTEELDQVWEPKRVDITRPDVLLGSSWLDQQGCFGIVRDSSNMSDALALLLGGEDIENSYVTVGSSS
SGQAQQGVGSCTWTNMPPVWSL*

DNA
ATGAGTTACACGGCTGAGAGTGATGATGATGGTATGCACTCACCAGCTGGTGATAGTATTGGTGGTTATGGATGCAAGAG
CCGAGGGAAAGGAAGTGTCCTGAAGAAAGGACCGTGGACTTCGACTGAAGACGGGATTTTGATTAATTATGTGAGGAAGC
ATGGAGAGGGTAACTGGAACGCTGTGCAGAAATACACGAGCCTGGCTCGTTGCGGGAAAAGCTGTCGTCTCAGGTGGGCT
AATCATCTTAGGCCGAACTTGAAGAAAGGAGCGTTTAGCCAAGAAGAGGAACGTCTCATTGTTCAAATGCATGCCAAGAT
GGGGAATAAATGGGCACAGATGGCTGAACATTTGCCTGGTCGAACAGATAATGAGATAAAGAATTATTGGAACACTCGTA
TCAAGAGGCGCCACCGAGCAGGCTTACCGCTTTACCCTCCTGAACTCCACGTTGAAGATCTGCAGTTGAGTGAGGAGTAT
ACCACGAGCAATGTCACCAGGGTAAATAGAAGAAGACATCAAGATATCTTGCAGTTGGGGAATTCCAAGGCAGATGTCTT
GTTTGACGATCTTAATTTTGCTACCAACTTGTTACCTGGAGCTTCTGACGTATTAGATATGTTCACATGCAACATGCTAG
GAACTGGTGCGAGTAGTTCCCCGTACGAAAGCTACATGCCACCAATACTGCCTTCCCCAAAGCAGCTCCGAGAATCTGGA
TCTCTGTTTCCCTTGTGCAGCAGTAACATAAAGCAAGAGTTCCACTCTCCAGAACCTTTTCAGAATCCAAGATCTTGCAG
TATCTCGCCTTGTGATGTTGGTCATCATTCTCCTTACGGAAACCAACGTCCATCTGATGTGATGATTTCAGATAGCCATG
CCTTTATGGATGGCATGCTTCCTACTTCTAAGCCCTTGTTTGGGGCAGTGAAGCTGGAGCTCCCTTCATTCCAATATTCA
GAAACTAGTGGGTTTGATCAGTGGAAGACGACCACACCGTCACCTCCACACTCAGATCCTCTTGACTCTGTTGATGCTTA
TATTCAGTCTCCGCCGCCATTGGAGATTGAAGACGAGTCAAACTGTTTCTCGTCATGCGACACTGGCCTACTAGATATGT
TACTTCCCAATGCCAAGATCAAAACTAGTGCAAAGCGTAGTTTGGCTCTCCCCGAGATTCCAATTCCCACGCAACTTAGT
GCAGGTGAAACTTCAGCAGATTCTGCAGGGAACGTTGTGAAGACAGAAGAGTTGGATCAGGTTTGGGAACCAAAGAGAGT
TGATATAACACGGCCCGATGTTTTACTTGGATCGAGCTGGCTAGACCAACAAGGCTGTTTCGGGATTGTTAGAGACTCCA
GCAACATGAGTGATGCGCTTGCGCTTCTTCTCGGTGGTGAAGACATTGAAAACAGTTACGTGACTGTTGGGTCATCATCA
TCAGGTCAAGCACAACAAGGAGTTGGGTCTTGCACATGGACTAATATGCCTCCTGTTTGGTCCTTGTAA