Details for Kale Locus Bo5g136560

Position : C5 ( 5`- 42315901 .. 42317826 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136560

Protein [Map View]
MPSLRSDSSIKLITYSEELVDGKPLYASSNSLPVKALNREPAGHAFHSAALKLHGCAEEPTDSEGDDKKAGGDDKEKEYV
PSFNSYSNKGKKKSGTQQQDHYALLGLSNLRYLATEDQIRKSYREAALKHHPDKLASLLLTEETEEAKEAKKEEIESRFK
AIQEAYEVLMDPLKRRIFDSTDEFDDEVPTDCAPQDFFKVFGPAFKRNARWSVNQRIPDLGDENTKLKEVDRFYNFWYAF
KSWREFPDEEEHDLEQADSREERRWMEKENARATAKARKEEHARIRTLVDNAYRKDPRIVKRKEEEKAEKQQKKDAKLMA
KKKQEEEAAIAAAEEKRRKEEEEKRAVESAQQQKKAKEKEKKLIRKERNRLRTLSAPVVAQRLLDISEEDIENLCMTLNI
EQLQSLCDKMGNKEGLELAKVIRDGCSDSSRDQEANSKEKESEKTNGGGAERVSVLESTQKKQPWSKEEIDMLRKGMIKY
PKGTSRRWEVISEYIGTGRSVEEILKATKTVLLQKPDSSKAFDSFLEKRKPTATIASPLSTREELGESLPATAKVKPPVK
ETVVVGQSSESNGEASGSSVETDGWSAVQERALVQALKTFPKETSQRWERVAAAVPGKTVIQCKKKFAELKEIIRSKKTA
V*

DNA
ATGCCGAGCCTTAGAAGCGACTCTTCCATTAAGCTGATCACATACTCTGAGGAGCTTGTTGATGGAAAACCGCTGTACGC
TTCTTCAAATTCCCTTCCCGTGAAGGCCTTAAACCGCGAGCCTGCGGGCCACGCCTTCCACTCCGCGGCTCTCAAACTCC
ACGGCTGCGCAGAGGAGCCCACAGACAGCGAAGGCGATGACAAGAAAGCCGGAGGAGACGATAAAGAGAAGGAGTACGTT
CCTTCCTTCAACTCGTATTCAAACAAAGGAAAGAAGAAGTCCGGCACGCAGCAGCAAGACCACTACGCCTTGCTGGGGCT
GAGCAACTTGAGGTACCTCGCAACAGAGGATCAGATCAGGAAAAGCTACCGCGAAGCCGCCTTGAAGCACCATCCTGACA
AGCTCGCTTCTCTCCTTTTAACAGAGGAGACTGAAGAAGCCAAGGAGGCTAAAAAAGAGGAGATAGAGTCTCGCTTCAAG
GCGATCCAAGAGGCTTACGAGGTGCTGATGGATCCGTTAAAGAGGAGAATCTTCGACTCTACCGATGAGTTCGACGACGA
GGTCCCCACGGACTGCGCGCCACAGGACTTTTTCAAGGTGTTCGGTCCAGCTTTCAAGAGGAACGCTAGGTGGTCTGTGA
ACCAGCGTATACCTGATCTTGGAGACGAGAACACGAAGCTCAAGGAGGTTGACAGGTTCTACAACTTCTGGTACGCTTTC
AAGAGTTGGAGGGAGTTTCCTGATGAAGAGGAACATGATCTTGAACAAGCGGATTCGCGCGAGGAAAGGAGGTGGATGGA
GAAGGAGAACGCTAGAGCAACGGCCAAGGCTAGGAAGGAGGAGCACGCTAGGATCAGGACTCTTGTCGACAACGCGTATA
GGAAAGATCCGAGGATTGTGAAGAGAAAAGAAGAGGAGAAGGCTGAGAAGCAGCAGAAGAAGGACGCGAAGCTTATGGCT
AAGAAGAAGCAGGAGGAGGAAGCTGCTATCGCCGCTGCGGAAGAGAAGAGGAGGAAAGAGGAAGAGGAGAAGCGAGCGGT
GGAGTCTGCACAGCAGCAGAAGAAGGCTAAGGAGAAGGAGAAGAAGCTCATACGCAAAGAGCGTAACCGTCTCAGGACTC
TCTCAGCTCCTGTGGTGGCTCAGCGTCTGCTTGACATCTCAGAGGAAGATATAGAGAATCTTTGCATGACGCTTAACATC
GAGCAGCTGCAGAGTCTTTGCGATAAGATGGGAAACAAAGAAGGGCTAGAGTTGGCTAAGGTGATCAGAGACGGGTGCAG
CGACAGTAGTAGAGACCAAGAAGCCAACTCTAAAGAGAAAGAAAGCGAGAAAACCAACGGTGGCGGTGCAGAGAGAGTCT
CTGTGTTGGAGAGCACTCAGAAGAAACAACCATGGAGCAAGGAAGAGATTGATATGCTGAGAAAAGGAATGATAAAATAT
CCAAAGGGGACGTCTCGGAGATGGGAAGTTATATCAGAGTACATCGGTACAGGAAGATCAGTTGAGGAGATTCTTAAAGC
AACTAAGACCGTTCTTCTCCAAAAACCAGATTCCTCCAAAGCGTTTGACTCGTTCCTCGAGAAGAGGAAACCCACTGCTA
CAATCGCTTCCCCTCTCTCCACAAGAGAGGAGCTGGGAGAGTCTCTACCGGCAACAGCAAAGGTGAAACCACCTGTTAAA
GAGACTGTTGTTGTTGGTCAAAGCTCGGAGAGCAATGGTGAAGCAAGTGGAAGTTCAGTAGAGACAGATGGTTGGTCTGC
TGTGCAAGAAAGAGCTTTGGTTCAGGCTTTGAAGACATTCCCCAAAGAGACAAGCCAAAGATGGGAGAGAGTAGCTGCAG
CTGTTCCTGGGAAGACTGTGATTCAGTGCAAGAAGAAGTTTGCAGAGCTTAAGGAAATCATCAGAAGCAAGAAAACTGCA
GTCTAA