Details for Kale Locus Bo5g136540

Position : C5 ( 5`- 42311212 .. 42312763 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136540

Protein [Map View]
MRISVMSQMHRSFSIDLPSLIPLQLPSRRETHLWYVIPDEVKSTSLLKRYSQLLSPIEKDGVDQMRGDELKKNALLARTL
VRTTIARYQTNKEVDPRSLMFKKNVYGKPEVDWQNCNNQPLHFNISHTDSLIACGVTVHVPVGIDVEDKERKIKHDVLAF
AKRFYSADEVNVLATILDPEVQRKEFIKLWTLKEAYVKALGKGFSAAPFNTFTIQSMPGTEGAYNLCKTSEVTADPPEET
KKCNGGWKFALFDLADSHYAAVCTEDDQANEGAPTKIIVRKTIPFVEDQLISERIFL*

DNA
ATGAGAATCAGTGTCATGTCTCAAATGCACCGAAGCTTCTCGATCGATTTGCCTTCACTGATCCCTCTGCAACTTCCATC
TCGTAGGGAGACTCACCTATGGTATGTTATACCAGATGAAGTGAAAAGCACATCTCTTTTGAAACGCTACTCACAACTTC
TCTCGCCAATTGAGAAAGATGGAGTTGATCAGATGCGTGGCGATGAGCTCAAGAAGAATGCTTTGCTTGCCCGCACCTTG
GTTCGAACCACCATTGCTAGATATCAGACAAACAAGGAGGTCGATCCTCGATCCTTGATGTTCAAGAAGAACGTGTATGG
GAAGCCTGAGGTAGATTGGCAGAACTGCAATAACCAGCCATTGCATTTCAACATCTCCCACACAGACTCTTTAATTGCCT
GTGGGGTGACAGTACATGTTCCCGTTGGTATTGATGTTGAAGACAAGGAAAGGAAGATAAAACATGATGTCTTAGCATTC
GCAAAAAGATTTTACTCTGCTGATGAAGTGAACGTTTTGGCAACTATACTGGATCCAGAAGTTCAGAGAAAGGAATTTAT
TAAGCTATGGACTCTTAAGGAGGCATATGTGAAAGCATTAGGAAAAGGCTTCTCCGCTGCACCTTTTAATACCTTCACAA
TCCAGTCTATGCCTGGAACAGAGGGAGCCTACAACCTTTGCAAGACATCTGAAGTGACAGCCGATCCACCGGAGGAGACA
AAGAAATGCAACGGAGGATGGAAGTTTGCCCTTTTTGATTTGGCTGATTCTCATTATGCTGCAGTCTGTACTGAAGATGA
TCAAGCTAACGAAGGAGCTCCTACGAAGATCATTGTTCGGAAAACCATCCCCTTTGTAGAAGACCAACTTATTTCTGAAA
GAATATTTCTGTAG