Details for Kale Locus Bo5g136470

Position : C5 ( 5`- 42254624 .. 42256127 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136470

Protein [Map View]
MARVLKSTQSCHFPSPSSSCGGSNDGNRDPHSLFNIPLDEEQEEDERSQKERERFELSSSLEILASAIRKSLIGGCVGQE
INISSMEIGVPTDVRHVAHVTFDRFHGFLGLPVEFEPEVPTRPPSASAKVFGVSTESMQLSYDTRGNVVPTILLMMQSHL
YSRGGLRVEGIFRINGENGQEEYIREELNKGVVPDNIDVHCLASLIKAWFRELPTGVLDSLSPEQVMESESEEECVELVR
MLPSTEASLLDWSINLMADVVEMECLNKMNARNIAMVFAPNMTQMLDPLTALMYAVQVMNFLKTLIVKTLKDRKESRDRL
VPGSNPGPRDENGDQGSRQLLHLMEVNKEVALDTVEVEMKDKEESEVQEEYAEPREILGVKSSLNKSCQYNNNGGFGKKQ
KGWEEKRKMKNASSIVGRVNYRVELFEAWR*

DNA
ATGGCTAGAGTGCTAAAATCCACCCAATCATGCCACTTCCCTTCCCCTTCAAGCTCCTGCGGAGGCAGCAATGATGGTAA
CAGAGACCCACATTCTCTTTTTAACATTCCTCTCGACGAAGAACAAGAAGAAGACGAAAGAAGCCAGAAAGAGAGAGAAA
GATTCGAGCTTTCGTCTTCCTTGGAGATTCTCGCTTCTGCTATCAGAAAGTCTTTAATCGGTGGCTGCGTTGGCCAAGAG
ATAAATATTTCTTCAATGGAGATTGGTGTCCCTACAGACGTTAGACACGTCGCTCACGTCACCTTCGACCGTTTCCACGG
CTTCCTCGGCTTGCCCGTTGAGTTCGAACCTGAAGTCCCTACACGCCCTCCTAGTGCAAGTGCAAAGGTGTTTGGTGTCT
CGACCGAGTCAATGCAGCTGTCTTACGATACTAGAGGGAACGTTGTGCCTACGATACTCTTGATGATGCAGAGTCACTTG
TACAGTAGAGGAGGGTTAAGGGTAGAAGGAATCTTCAGGATTAATGGTGAGAATGGTCAAGAAGAGTACATAAGAGAAGA
GTTGAACAAAGGTGTTGTACCTGACAACATTGATGTTCATTGCTTGGCAAGTCTCATTAAGGCTTGGTTTAGGGAGCTTC
CTACTGGTGTGTTGGACTCACTCTCGCCAGAGCAAGTGATGGAGTCTGAAAGCGAAGAAGAGTGTGTTGAGCTTGTGAGG
ATGCTTCCTTCAACGGAAGCTTCTTTGTTGGATTGGTCAATTAATCTGATGGCTGATGTTGTGGAGATGGAATGTCTTAA
CAAGATGAATGCGAGAAACATAGCTATGGTTTTCGCACCTAACATGACTCAGATGTTGGATCCTTTGACGGCACTAATGT
ATGCTGTGCAAGTCATGAACTTTCTTAAGACACTTATTGTGAAGACGCTTAAGGACCGGAAAGAGTCTCGAGATAGGTTG
GTTCCAGGTTCGAACCCGGGTCCTAGGGACGAGAATGGTGATCAGGGCAGCAGACAGTTGTTGCATCTCATGGAAGTTAA
CAAGGAGGTTGCTTTGGATACCGTTGAGGTGGAAATGAAAGACAAAGAGGAGTCTGAAGTACAAGAAGAATATGCAGAAC
CTAGAGAGATTCTTGGTGTAAAGTCGTCTCTGAATAAAAGCTGTCAGTATAATAACAATGGAGGTTTTGGAAAGAAACAG
AAAGGTTGGGAGGAGAAGAGGAAGATGAAGAATGCTAGTAGTATTGTGGGACGTGTGAATTACAGAGTTGAGCTTTTTGA
AGCTTGGCGGTGA