Details for Kale Locus Bo5g136460

Position : C5 ( 5`- 42251960 .. 42252884 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136460

Protein [Map View]
MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGDDKTDIGMVVIRGNSIVTVEALEPVGRS*

DNA
ATGAGTCGATCAGGTCAGCCTCCGGATCTCAAGAAGTACATGGACAAGAAGCTCCAAATTAAGCTGAATGCCAACAGAAT
GGTTGTTGGAACTCTCCGTGGGTTTGACCAGTTCATGAATCTTGTGGTGGATAACACTGTTGAAGTCAATGGTGATGACA
AAACTGACATTGGCATGGTGGTGATAAGAGGAAACAGCATTGTCACCGTTGAAGCTCTTGAACCAGTTGGAAGATCTTAG