Details for Kale Locus Bo5g136410

Position : C5 ( 5`- 42214906 .. 42218138 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136410

Protein [Map View]
MFVYSPSHPVRLDLTVAASRAAPLKPSFHRSSYYRRASIKSTWRSLPEPPKHPLHRVETTNHLSSFTLFLNIGELHRLNR
DLIQQIKTANHRNHEPITTPDPESGTNPYPTKRLKHLKPATQDYESLHPPETKAGVGGAEEAPTSRRLGRRRRSWISLHL
PDSKLKLTSLLHHTKTLHTTASLFQPLSHHRCRFTPRVDDDGWELDKSSDKAIGDSRRRRTKVTTKSHRLFYRRRRSVNS
RPPLATTFLNRRHADDYRRLAGLAFMFSSSILLQILACAIYSNWWPMLSALMYVVVPMPCMFFGGGSTQFLISRDGGGWI
DAAKFLTGASTVGSLAIPIILRHAGMIETGAMLIEFTSFFIFICTVMCFHRASLDDDW*

DNA
ATGTTCGTATATTCACCATCTCATCCCGTTCGCCTCGACTTGACCGTCGCCGCTTCGAGAGCAGCACCACTGAAACCCTC
GTTTCATCGGAGCTCATATTACCGTCGAGCTTCCATCAAATCAACTTGGAGATCTCTTCCCGAGCCTCCCAAACACCCTC
TCCATAGAGTTGAAACCACGAACCATCTCTCTTCATTCACGCTTTTTCTTAACATCGGAGAGCTTCATCGATTAAATCGA
GATCTCATCCAGCAGATCAAAACCGCGAACCACAGGAACCATGAACCAATAACCACCCCCGATCCAGAATCGGGAACAAA
CCCTTACCCCACTAAAAGATTGAAACACCTAAAGCCGGCGACGCAAGACTATGAAAGCCTTCACCCCCCGGAGACAAAAG
CCGGCGTTGGCGGAGCTGAAGAAGCCCCCACCTCCCGGAGACTAGGCCGGCGGCGACGGAGCTGGATAAGCCTCCACCTC
CCGGATTCGAAACTTAAACTGACAAGCCTACTTCACCACACCAAAACCCTCCACACGACCGCGTCGTTATTCCAGCCGCT
TAGCCACCATCGATGTCGGTTCACTCCCCGAGTTGACGACGACGGTTGGGAGCTGGACAAGAGTTCAGACAAGGCGATCG
GGGATAGCAGGCGAAGGAGAACCAAAGTAACCACGAAATCTCACCGTCTTTTTTACCGTCGCCGGCGATCGGTCAACAGT
CGACCTCCGTTAGCCACAACTTTCCTCAATCGCCGACATGCCGATGACTATCGAAGACTTGCTGGACTTGCCTTCATGTT
TTCATCAAGTATCCTCCTACAGATCCTGGCTTGCGCGATATATAGTAACTGGTGGCCAATGCTGTCAGCACTCATGTATG
TGGTTGTGCCTATGCCATGCATGTTCTTTGGAGGAGGCTCAACACAATTCCTAATTAGTCGAGATGGTGGAGGGTGGATA
GATGCAGCGAAGTTCTTGACAGGAGCATCAACGGTGGGAAGCCTGGCGATTCCAATCATTTTAAGGCATGCAGGAATGAT
CGAGACGGGTGCAATGCTGATAGAATTCACATCGTTCTTCATATTCATATGCACCGTCATGTGTTTTCACAGGGCTAGCC
TGGATGATGATTGGTAA