Details for Kale Locus Bo5g136390

Position : C5 ( 5`- 42207546 .. 42208323 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136390

Protein [Map View]
MKNESTFIDVPAESSSAMKGKAPLIGVAKDHTTSGSGGYNRGLSIFDFLLRLAAIVAASVAAGTMFTSDETLPFFTQFLQ
FEAGYDDLPTFQFFVIAMSMVAGYIVLSLPISVVTIVRPLAAAPRLLLLVLDTAIMGLTMAAASSAAAISYVAHNGNQNT
NWLPICQQFGDFCQKTSGAVVSSFVAVVFFMILVVLSGVALKRH*

DNA
ATGAAGAACGAATCTACATTCATTGATGTTCCTGCAGAGTCCAGCTCAGCAATGAAAGGGAAAGCTCCTCTAATCGGTGT
GGCTAAAGACCACACTACTAGTGGCTCAGGTGGATACAATAGAGGCCTTTCGATCTTTGACTTCCTCCTCCGTTTAGCTG
CCATTGTTGCAGCATCAGTGGCCGCTGGAACGATGTTTACAAGCGACGAGACTCTTCCTTTCTTTACACAGTTCTTACAG
TTCGAAGCTGGCTACGATGATCTACCAACTTTCCAATTCTTTGTGATTGCCATGTCAATGGTTGCAGGATACATAGTCCT
CTCACTTCCTATCTCCGTAGTCACCATCGTTCGCCCTCTCGCCGCCGCTCCAAGACTCCTCTTGCTCGTTCTTGACACTG
CGATTATGGGGTTGACCATGGCGGCTGCATCTTCGGCGGCAGCGATATCTTATGTAGCACACAATGGAAACCAGAACACG
AACTGGCTTCCCATTTGCCAGCAGTTTGGTGACTTCTGTCAGAAGACCAGCGGAGCTGTTGTCTCCTCCTTTGTCGCCGT
TGTATTCTTCATGATCCTGGTCGTTCTCTCCGGCGTCGCTCTCAAGAGGCACTAA