Details for Kale Locus Bo5g136380

Position : C5 ( 5`- 42201176 .. 42207044 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136380

Protein [Map View]
MAAKLHRPALVSSSSSTPCQPRISFVSFVSCKKAAVRLDCLSSPRSQLFVRYGFLERSSHYKKKARRSLVQPFLLASAEE
GVAVNGSPQSGGSNSAFGEARAKLTGSLQEESYCNGLIQSLHDAARTLEFAVKEKITPPRFSWFSATWLGADRYAWLKNL
SYQASLYSLLQAVNEISSRGNNRDEDVNVFVQRSLSRQAAPLENMMRDTLSSKHPEAYEWFWSEQVPFVVTSFVNYIEGD
QRFLAATSFYTKGKSSAASNEIEVSLLMLVLSSIAAITKLGPAKFSCPPFFSSLPDTTGRLMEKVVDFVPLPQAYHSVKS
IGLQREFLTHFGHRAALGLKGDVATDEVVFWVDLIQKQLQRAIDREKIWSRLTTSESIEVLERDLAIFGFFIALGRSTQS
YLAANGFDSLENPLEDLVRHLIGGSVLYYPQLSAISSYQLYVEVVCEELEWIPFYPNGTGAQPPKQSHRNRSKPEGPPNY
EVIPQVLDVCSFWLQSFIKHSKWPENPSNVKAAKFLSKGHKSVIRCREELAISKNASSAVRESDSFDKALESVDEALVRL
ESLLQELYVSNLSSGKEQIKAACSDLEKIRKLKKEAEFLEATFRAKTASLQQEGDKNDSRESYEVQKRYFKGKITKNAIS
SEGEGKSVSRRFWGFFERPPKSNPDPELSGGDIVGNPSGDLLRIDSEPNEISRFEILRNELIELEMRVKRSTAQSIDDEE
RISEDPPQPSSRPTGVQLVQISKKENMIEKTLHKLRETTTDVWQGTQLLAIDSAAAMKLLRRSMIGDELTQKEKKALRRT
MTDLASVIPIGILMLLPVTAVGHAAMLAAIQRYVPGLIPSTYGPERLNLLRQLEKVKELQTNETEPEESIEKIAYD*

DNA
ATGGCAGCTAAACTACATCGACCTGCTCTCGTATCTTCAAGCTCTTCAACGCCATGTCAGCCGCGGATCTCCTTTGTATC
GTTCGTATCCTGCAAAAAGGCGGCGGTGCGGTTGGATTGTTTGAGCAGTCCTAGGAGCCAATTGTTTGTGAGATATGGGT
TTCTCGAAAGGAGTTCGCATTACAAGAAGAAAGCACGGAGGAGTCTGGTGCAGCCTTTTCTCCTGGCTTCTGCTGAAGAG
GGAGTAGCTGTTAACGGAAGTCCTCAGTCAGGAGGATCTAATAGTGCTTTTGGGGAGGCTAGGGCTAAGCTCACCGGATC
GTTGCAAGAGGAAAGCTACTGTAATGGACTCATCCAGTCTCTGCACGATGCTGCGAGAACTCTTGAGTTTGCTGTCAAGG
AGAAGATTACTCCGCCTAGGTTTTCGTGGTTTTCTGCTACTTGGCTGGGAGCTGATAGATATGCTTGGTTGAAGAATCTT
TCGTATCAGGCTTCTCTGTACTCCTTACTACAAGCGGTTAATGAGATTTCGTCGAGAGGCAATAACAGAGACGAGGATGT
TAACGTCTTCGTTCAGAGGAGTTTATCACGCCAAGCTGCTCCCCTTGAGAATATGATGCGGGATACTCTATCATCCAAAC
ATCCTGAAGCCTATGAATGGTTTTGGTCTGAGCAAGTTCCTTTTGTAGTGACATCTTTTGTGAATTATATTGAGGGGGAT
CAACGATTTCTGGCCGCCACTTCTTTCTATACTAAAGGAAAGTCCTCCGCTGCAAGTAATGAGATAGAGGTGTCACTTCT
CATGCTTGTGCTCAGTTCCATTGCAGCAATCACGAAACTTGGCCCGGCAAAATTTTCCTGCCCGCCCTTTTTTTCTTCGC
TTCCAGATACAACTGGAAGATTGATGGAAAAAGTTGTAGACTTCGTTCCACTCCCTCAAGCGTATCATTCAGTCAAAAGC
ATAGGCCTACAAAGAGAATTTCTTACTCATTTTGGTCATCGGGCAGCACTGGGCCTAAAAGGTGACGTTGCTACAGATGA
AGTTGTTTTCTGGGTCGATCTTATACAGAAACAACTGCAGCGGGCTATAGATCGGGAAAAAATATGGTCAAGGTTAACAA
CTTCCGAAAGTATAGAGGTTTTGGAGAGGGATTTAGCCATCTTTGGATTCTTCATTGCCTTGGGCAGGAGCACGCAGTCC
TATTTAGCTGCAAATGGTTTTGATTCTCTTGAGAACCCTTTGGAAGACCTTGTTAGGCATCTCATTGGGGGCAGCGTCCT
GTACTATCCTCAACTTTCAGCCATTAGTTCATACCAACTTTATGTAGAGGTTGTTTGCGAAGAGCTAGAATGGATTCCTT
TCTATCCAAACGGTACTGGCGCACAGCCTCCGAAACAATCACACAGGAATAGGAGCAAACCAGAAGGGCCGCCTAATTAC
GAAGTTATTCCCCAAGTGCTGGATGTTTGCTCTTTTTGGCTACAGAGCTTCATTAAACATAGTAAATGGCCAGAGAACCC
TTCTAATGTCAAGGCTGCAAAATTCCTATCCAAGGGGCACAAGAGTGTGATTAGGTGCAGGGAAGAACTGGCGATATCAA
AGAATGCGTCATCAGCTGTAAGAGAGTCGGACTCCTTTGACAAGGCCCTAGAAAGTGTAGATGAAGCCCTCGTGAGATTG
GAAAGCCTGCTACAGGAGTTGTACGTATCCAACTTATCGTCTGGAAAGGAACAAATAAAAGCCGCTTGCTCTGACCTTGA
GAAAATACGGAAGCTTAAAAAAGAGGCTGAGTTTTTGGAGGCAACTTTCAGAGCCAAAACAGCTTCCCTGCAACAGGAAG
GTGACAAAAACGATTCTCGGGAATCCTACGAGGTACAAAAACGGTATTTTAAGGGCAAAATCACAAAGAATGCAATTAGT
TCTGAAGGTGAAGGCAAAAGTGTGAGTCGTAGATTCTGGGGATTCTTTGAACGGCCTCCAAAGAGTAATCCTGATCCTGA
ATTATCGGGTGGTGATATTGTTGGGAATCCCAGTGGAGACTTACTTCGCATAGACTCGGAACCGAATGAAATTAGTCGAT
TTGAAATCCTAAGGAACGAACTGATAGAACTGGAAATGCGGGTTAAAAGAAGCACTGCTCAGTCAATAGATGATGAGGAA
AGAATATCTGAGGACCCTCCTCAACCAAGCAGTAGACCGACAGGCGTTCAGTTGGTACAAATTTCAAAGAAGGAAAACAT
GATCGAGAAAACTCTTCACAAGCTAAGAGAAACCACAACGGACGTGTGGCAAGGTACTCAGCTGCTCGCCATTGACTCAG
CAGCTGCTATGAAGCTACTTCGTCGCTCTATGATCGGTGATGAATTAACACAAAAAGAAAAGAAAGCTCTGCGCAGAACC
ATGACTGACTTGGCATCGGTCATTCCCATCGGTATTCTGATGCTTCTTCCTGTTACAGCGGTTGGTCACGCAGCTATGCT
GGCTGCAATTCAGAGATATGTCCCAGGCCTGATTCCTTCCACATACGGGCCAGAAAGGTTGAACCTATTGAGACAGCTTG
AGAAAGTCAAGGAACTGCAAACAAATGAAACTGAGCCCGAAGAAAGCATCGAGAAAATAGCATATGACTAG