Details for Kale Locus Bo5g136370

Position : C5 ( 5`- 42199523 .. 42201154 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136370

Protein [Map View]
MDHHQESNSLKQLFSLSSSPFFSTFKTKKHIFVGTSLLISFLIISVIFVDLARFEPHLYFGFLSSSSKTLTKEQSSNNVC
DYSYGKWVRRRQLDPEETSYGEECRFLDPGFRCLNNGRKDSSFRQWRWQPHDCDLPRFNARDFLERSRNGRIVFVGDSIG
RNQWESLLCMLSQAVSNKSEIYEVNGNPISKHKGFLSMRFPEQNLTVEYHRTPFLVVVARPPENSPEDVKMTVRVDEFNW
QSKRWVGSDVLVFNTGHWWNEDKTFNSGCYFQEGGKLNKTMGVMEGFEKSLKTWKSWILEKLDSESSYVFFRSFSPVHYR
NGTWNLGGLCDADTEPETDMMKMEPDPIHNSYISEVIQGMRYEHSKVKFLNITYLTEFRKDAHPSRYREPGTPEDAPQDC
SHWCLPGVPDTWNEILYAQLLAMNYRTK*

DNA
ATGGATCATCATCAAGAATCAAATTCTCTAAAGCAGCTCTTCTCTCTATCTTCATCTCCTTTCTTCTCAACCTTCAAGAC
CAAGAAACATATTTTTGTGGGGACTTCTCTTCTCATCAGTTTCCTAATAATCTCCGTTATATTCGTCGATCTAGCCCGCT
TCGAGCCTCATCTATATTTTGGATTCTTATCTTCATCATCGAAAACACTAACGAAGGAACAAAGCAGCAATAACGTATGC
GACTATTCGTACGGAAAATGGGTTCGTAGACGACAACTTGACCCGGAAGAAACGTCTTACGGAGAAGAGTGTCGGTTTCT
GGATCCTGGTTTTCGTTGTCTGAATAACGGAAGAAAAGATTCTAGTTTCCGACAATGGCGATGGCAGCCACACGACTGCG
ATCTTCCACGATTCAACGCAAGAGATTTTCTGGAGAGGAGTAGGAACGGGAGGATTGTGTTCGTCGGAGATTCCATCGGA
AGAAACCAATGGGAATCTCTTTTGTGTATGCTTTCACAAGCCGTGTCTAACAAGTCTGAGATATATGAAGTAAACGGGAA
CCCAATAAGCAAGCATAAGGGTTTCCTCTCAATGCGGTTTCCAGAACAAAACCTAACGGTCGAATATCATAGAACACCTT
TTCTTGTCGTGGTTGCTAGACCACCTGAGAACTCACCGGAAGATGTCAAGATGACTGTTAGAGTAGACGAGTTTAACTGG
CAGTCAAAAAGATGGGTCGGGTCTGATGTTCTGGTCTTCAACACAGGACATTGGTGGAACGAAGACAAAACCTTCAACTC
AGGTTGCTATTTTCAGGAGGGAGGTAAATTGAACAAAACAATGGGAGTAATGGAGGGATTTGAGAAGTCTTTGAAGACAT
GGAAGTCATGGATATTAGAAAAGCTAGATTCTGAGAGCAGCTATGTCTTCTTCAGAAGCTTTTCTCCCGTGCATTACAGG
AATGGGACATGGAACTTGGGTGGTTTGTGTGATGCAGATACAGAGCCAGAGACTGATATGATGAAAATGGAACCTGACCC
TATCCACAACAGTTATATCTCTGAAGTAATACAAGGAATGCGGTATGAACATAGTAAGGTTAAGTTTTTGAACATTACAT
ATCTGACCGAGTTCAGGAAAGATGCTCATCCTTCGCGGTATCGAGAGCCAGGAACTCCTGAAGATGCTCCTCAAGATTGC
AGTCACTGGTGCTTACCCGGTGTGCCCGACACATGGAATGAGATCCTCTATGCGCAGCTGTTGGCAATGAATTACCGAAC
AAAATGA