Details for Kale Locus Bo5g136330

Position : C5 ( 5`- 42151625 .. 42154434 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136330

Protein [Map View]
MPRQNQTVENLLLLGKIRKRGCSSPTSSTSSVLREGYRFKRAIVVGKRGGSTTPVPTWRLMGRSPSPAASPSQCGSKTGR
GAPAAPVSARKLAATLWEMNEMPSSPRGVEEATSRKVRKERIAPLPPPPPPRSVRSGSLPPHLSDPSHSPVSERMERSGT
GSRQRRASSTVQKLRLGDHNVVARDRISNASFMDIETRSRAETPTGSTTVGVKTRLKDCSNALTTSKELLKIINRMWGQE
DRPSSSMSLVSALHSELERARLQVNEVIREHKPENSDVTYLMKRFAEEKAAWKSHEQEVVEAAIESVAGELEVERKLRRR
FEGLNKKLGKELSDTKAALMKAVKEIENEKRARVMVEKVCDELARDISEDKAEVEELKRESFKVKEEVEKEREMLQLADA
LREERVQMKLSEAKHQLEEKNAAVDKLRNQLQTYLKAKRCKEKSIEPPQTEEYLNHHIGFGSYNIEDGEVEDENEEDSGG
ESDLHSIELNMENKSYKWPYGEENNRVGRKSTPSKSLSLQRSISDCVDWVVQSEKLQKSGDGGLDWGRSVEVEPKGYLDE
TQAYKPSKASSKDHLLSGPRLSNFRGGSVSKSRLSDAAKGENQNARKSRW*

DNA
ATGCCGAGGCAGAACCAAACGGTGGAGAATCTCCTCCTCCTCGGGAAAATCAGGAAGCGCGGATGCTCCTCTCCGACGTC
GTCGACTTCCTCCGTTCTCAGGGAAGGCTACCGTTTCAAGAGAGCGATTGTCGTCGGGAAAAGAGGAGGATCCACCACTC
CTGTCCCCACGTGGAGGCTCATGGGCCGATCTCCTTCTCCGGCTGCTTCTCCGTCGCAGTGCGGGAGCAAGACCGGGAGA
GGAGCGCCTGCGGCTCCTGTTTCGGCGAGGAAGCTGGCTGCGACTCTGTGGGAGATGAACGAGATGCCTTCTTCGCCGAG
AGGTGTGGAAGAGGCAACGAGTAGAAAGGTTAGAAAGGAGAGAATCGCGCCGCTTCCTCCTCCTCCTCCGCCGAGGTCGG
TCCGTTCTGGTTCTCTGCCGCCTCACCTCTCTGATCCTTCGCATAGTCCTGTCTCTGAGAGGATGGAAAGATCAGGGACT
GGAAGCCGACAGAGAAGAGCATCCTCCACTGTGCAGAAGCTTAGGCTTGGAGATCATAATGTGGTGGCTAGGGATCGTAT
TAGCAACGCTAGCTTCATGGATATTGAGACAAGATCACGAGCAGAGACACCGACTGGGTCAACAACCGTGGGAGTGAAAA
CACGGTTGAAGGATTGTAGTAACGCTCTCACAACATCGAAAGAGCTTCTCAAAATCATCAACAGAATGTGGGGTCAAGAA
GACCGCCCATCTTCCAGCATGTCCCTCGTCTCCGCTCTCCACTCCGAGCTCGAAAGAGCTCGCCTACAGGTCAACGAGGT
CATCCGCGAACACAAACCGGAAAACAGCGACGTCACCTACCTGATGAAGCGTTTCGCCGAAGAGAAAGCGGCGTGGAAAA
GCCACGAGCAAGAAGTCGTCGAGGCCGCGATAGAATCCGTCGCCGGCGAGCTCGAGGTGGAGAGGAAGCTGAGGAGAAGG
TTCGAGGGGTTGAACAAGAAGCTAGGCAAAGAACTATCCGACACAAAAGCAGCTCTGATGAAAGCAGTGAAGGAGATAGA
GAACGAGAAGCGAGCGAGAGTGATGGTGGAGAAAGTCTGCGACGAGCTAGCGAGAGACATCAGCGAAGACAAAGCCGAGG
TCGAAGAGCTGAAGAGAGAGTCTTTCAAAGTGAAAGAAGAAGTCGAGAAGGAGAGAGAGATGCTGCAGTTAGCTGACGCG
TTGCGGGAGGAGAGAGTGCAGATGAAACTCTCGGAGGCTAAGCACCAGCTCGAGGAGAAAAACGCGGCTGTTGATAAGCT
GAGGAACCAGCTTCAAACCTACCTCAAAGCAAAGAGATGCAAAGAGAAGAGCATTGAACCGCCTCAGACTGAAGAGTACC
TAAACCACCACATCGGTTTCGGTTCTTATAACATCGAAGATGGAGAAGTTGAGGACGAAAACGAAGAAGATTCAGGCGGA
GAAAGCGATCTTCACTCCATAGAACTGAACATGGAGAACAAGAGCTATAAATGGCCTTATGGAGAAGAGAACAACAGAGT
AGGGAGAAAGTCAACGCCGAGTAAAAGCCTTTCTTTACAGAGAAGCATATCGGATTGTGTTGATTGGGTTGTACAGAGCG
AGAAGCTTCAGAAAAGTGGAGACGGAGGATTGGACTGGGGAAGATCTGTTGAGGTTGAGCCTAAAGGTTACTTGGATGAA
ACGCAAGCGTATAAACCAAGCAAGGCTTCTTCAAAAGATCATCTCCTCTCGGGTCCAAGACTAAGTAACTTCCGCGGTGG
ATCAGTTTCGAAGTCGCGGTTGTCTGATGCAGCCAAAGGTGAAAACCAGAATGCTAGAAAATCAAGATGGTAA