Details for Kale Locus Bo5g136320

Position : C5 ( 5`- 42146808 .. 42147164 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136320

Protein [Map View]
MRRRNRSGPKLELKLNLSPPPSQGEQMSMVRSPSRSNTASPNSCVSSEPSQEEMEKPISMVLVGCPRCLMYVMLSQDEPK
CPKCKSTVLLDFFHENASADTTAPAVTTKRNKSFITNI*

DNA
ATGAGACGGAGGAACAGGAGCGGTCCTAAGCTCGAGTTGAAGCTGAACCTTTCGCCACCTCCTTCTCAAGGCGAGCAGAT
GAGTATGGTTCGGTCTCCAAGCAGATCAAACACAGCTTCACCAAACTCATGCGTTTCCTCTGAACCGAGCCAGGAGGAGA
TGGAGAAACCAATCTCAATGGTCCTCGTCGGTTGCCCTCGTTGCCTTATGTACGTTATGCTCTCTCAGGATGAGCCAAAG
TGTCCTAAATGCAAAAGCACCGTCCTACTCGATTTCTTCCATGAAAACGCCTCTGCCGATACAACCGCTCCCGCCGTCAC
CACTAAACGCAATAAGAGCTTCATAACCAATATTTAA