Details for Kale Locus Bo5g136310

Position : C5 ( 5`- 42143737 .. 42145728 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136310

Protein [Map View]
MTEIMEIQAEDPKFHVLFIPGNPGVVPFYKDFLESLYEFLDGNASITAIGQISQTTKDWEPGRLFSLQEQIDHKVGFIRQ
DMEGVKVPIILVAHSIGSYISLDILRKFSEKVVYCIGLYPFLTLNKQSTKQSLIGKLAASSVLSATASFLIASLRLLPVW
AARRLVSNSLGASWSDTAVQATCTHLRQYHTMRNVLYMAMTEFRELAAEPDWDFMRENQSRLAFLFGIDDHWGPLQLFEE
ISKQAPGTSLSIEREGHTHAFCCTVAGSVWVAQHVATLIKNRFTHLQ*

DNA
ATGACGGAGATAATGGAAATTCAAGCTGAGGATCCCAAGTTCCATGTATTGTTCATCCCGGGGAATCCAGGTGTTGTGCC
ATTTTACAAGGACTTTTTGGAGTCTTTATACGAGTTTCTTGATGGAAATGCATCTATTACCGCTATTGGCCAAATATCTC
AGACGACCAAGGACTGGGAGCCTGGGAGGCTGTTTTCGTTACAAGAACAAATCGACCATAAGGTTGGCTTTATCAGACAG
GACATGGAGGGAGTGAAAGTTCCAATAATACTTGTTGCACACTCCATTGGTTCTTATATATCCCTTGACATTTTAAGGAA
GTTCTCTGAAAAGGTGGTATATTGCATTGGCTTGTATCCATTTCTGACTCTGAACAAACAGTCAACAAAACAATCATTAA
TTGGAAAACTTGCAGCGTCTTCTGTTCTATCGGCTACAGCAAGTTTTCTGATTGCATCACTGAGACTGTTACCTGTGTGG
GCTGCACGTCGGCTTGTATCTAACTCACTTGGAGCTTCATGGTCTGACACTGCTGTTCAAGCTACTTGCACTCACTTGAG
GCAGTATCACACCATGCGCAATGTTCTCTATATGGCAATGACAGAGTTTAGAGAGCTTGCAGCAGAGCCAGATTGGGACT
TCATGAGAGAAAACCAGAGCAGACTTGCATTTTTATTTGGCATTGATGATCATTGGGGTCCATTGCAACTCTTTGAAGAG
ATTTCAAAGCAGGCTCCTGGTACTTCCTTATCTATTGAGAGGGAAGGTCACACGCACGCGTTCTGCTGCACTGTGGCTGG
CTCGGTGTGGGTTGCTCAGCACGTAGCCACTCTGATCAAGAACCGGTTTACGCACCTCCAGTAA