Details for Kale Locus Bo5g136300

Position : C5 ( 5`- 42141867 .. 42143184 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136300

Protein [Map View]
MASVASSTALISSTRVSPAKSSLPSPSSLSFLRTISSPLRSSLSFCSRRSFAVKAQADDLPLVGNKAPDFEAEAVFDQEF
IKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYAEFEKLNTEVLGVSVDSVFSHLAWVQTDRQSGGLGDLNYPLV
SDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWQPGEKSM
KPDPKLSKEYFSAI*

DNA
ATGGCCTCTGTAGCTTCTTCAACCGCTCTCATCTCCTCCACTCGAGTTTCTCCAGCAAAGTCTTCGCTTCCATCTCCCTC
CTCCCTCTCTTTCCTTCGTACCATATCCTCTCCTCTCCGCTCTTCCCTCAGCTTCTGCTCTCGCAGGAGCTTCGCAGTCA
AGGCCCAGGCCGATGATCTTCCACTGGTGGGAAACAAGGCGCCTGATTTTGAGGCTGAGGCTGTCTTTGATCAGGAGTTC
ATCAAGGTGAAGCTCTCTGAGTACATTGGGAAGAAGTATGTGATTCTCTTTTTCTACCCTTTGGACTTCACTTTCGTCTG
CCCAACAGAGATTACTGCCTTCAGTGACCGCTATGCGGAATTTGAGAAGTTGAACACAGAAGTATTAGGTGTCTCTGTTG
ATAGTGTGTTCTCCCACCTTGCGTGGGTCCAGACAGACAGACAATCTGGAGGCCTTGGTGATCTCAACTATCCCCTTGTT
TCAGATGTAACTAAATCTATCTCAAAGTCTTTCGGAGTGCTCATCCATGATCAGGGAATAGCACTGAGAGGGCTTTTCAT
AATCGACAAGGAAGGTGTGATCCAACACTCCACCATCAACAATCTTGGTATTGGCCGAAGCGTCGATGAGACAATGAGAA
CCCTCCAGGCCTTACAGTACATCCAGGAGAACCCTGATGAAGTCTGCCCTGCAGGATGGCAACCGGGTGAGAAGTCAATG
AAACCTGACCCCAAGCTCAGCAAAGAGTACTTCTCTGCTATTTAG