Details for Kale Locus Bo5g136230

Position : C5 ( 5`- 42103835 .. 42106952 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136230

Protein [Map View]
MAKEIQSQSPPSPTTTGITFSSSSSSPSLSMMLSSTNAFSLLSKGWREVRDSADADLQLMRKRANSVKNLASTFDREIEN
FLNNSAMSAFPVVSSSPSAFGNEIGIMKKLEPKISEFRRVYSAPEISRKVMERWGPAKAKLGIDLSAIKKAIVSEMDLDE
REGVLEMRRRRDRDRFREFYAEGEGEGSFGDWKPIRSLKSRFKEFEKRSSLELLIGFKNSELVEKLKASFQSLYKETDEA
KDVPPLDVPELLASLVRQSEPFLDQIGVRKDLCDRVVENLYKCKSQHLWRLPSAQTSDLVENDNHVDDLDMRIASVLQST
GHHYDGGFWTDFLKPETPDSKRHVAIVTTASLPWMTGTAVNPLFRAAYLAKSAKQSVTLVVPWLCESDQELVYPNKLTFS
SPEEQESYIRTWLEERIGFKADFKISFYPGKFSKERRSIFPAGDTSQFIPSKDADIAILEEPEHLNWYHHGKRWTDKFNH
VVGIVHTNYLEYIKREKHGAIQAFFVNHVNNWVTRAYCDKVLRLSGATQDLPKSVICNVHGVNPKFLMIGEKIAEESTRG
EQAFSKGAYFLGKMVWAKGYRELIDLMAKHKSDLGSFNLDVYGNGEDAVEVQRAAQKLDLNLNFLKGRDHADDALHKYKV
FINPSISDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYKTSEDFVNKVKEAMSKEPLPLTPEQMYNLSWEAATQ
RFMEYSDLDKILNDEDGGKRMRKSRSVPSFDEVIDGGLAFTHYVLTGNDFLRLCSGATPKTKDYDKQHCKDLKLVPPQAH
KPVYGW*

DNA
ATGGCTAAAGAGATTCAATCTCAATCTCCTCCGTCGCCTACGACCACCGGGATCACGTTTTCTTCTTCTTCCTCCTCGCC
GTCTCTGTCGATGATGCTATCCTCCACCAACGCGTTCTCGCTACTCTCGAAAGGGTGGAGGGAGGTGCGGGACTCGGCCG
ATGCGGATTTGCAGCTGATGCGGAAACGAGCGAACTCCGTTAAGAATCTAGCGTCGACGTTCGACCGCGAGATCGAGAAT
TTCCTCAACAACTCGGCGATGTCTGCGTTTCCCGTCGTGTCGTCGTCTCCGTCGGCGTTTGGCAATGAGATTGGGATCAT
GAAGAAGCTTGAGCCGAAGATATCGGAGTTCCGCAGGGTTTATTCGGCTCCGGAGATCAGCCGTAAGGTGATGGAGAGGT
GGGGGCCAGCGAAGGCGAAGCTGGGGATCGATTTGTCGGCGATTAAGAAGGCGATTGTGTCTGAGATGGATCTGGATGAG
CGGGAAGGGGTTTTGGAGATGAGGAGACGGCGGGATAGGGATAGGTTTAGGGAGTTTTACGCGGAGGGAGAGGGAGAAGG
TAGTTTTGGAGATTGGAAGCCGATTAGGTCTTTGAAGAGTAGGTTTAAAGAGTTTGAGAAACGAAGCTCCTTAGAGTTAT
TGATTGGATTCAAGAACAGTGAGCTTGTGGAGAAGCTCAAAGCCAGCTTTCAATCACTTTATAAAGAAACTGATGAGGCC
AAGGATGTTCCACCACTGGATGTACCTGAACTTTTGGCATCTTTGGTTAGGCAGTCAGAACCGTTCCTTGATCAGATTGG
TGTAAGAAAGGATTTGTGCGACCGAGTAGTGGAAAACCTTTATAAATGCAAGAGCCAACACCTCTGGCGCCTGCCCTCTG
CACAAACATCTGATTTAGTTGAAAATGATAACCATGTTGATGATTTGGATATGAGGATAGCCAGTGTTCTTCAGAGCACA
GGACACCATTACGACGGTGGCTTTTGGACTGATTTTCTGAAGCCTGAGACGCCAGATAGCAAAAGGCACGTGGCAATAGT
TACAACAGCTAGTCTCCCGTGGATGACCGGAACAGCTGTAAATCCCCTGTTCCGAGCTGCCTATTTAGCAAAATCTGCAA
AACAGAGTGTCACACTCGTGGTTCCTTGGCTCTGCGAATCTGATCAAGAACTAGTTTATCCAAACAAGCTCACCTTCAGT
TCACCTGAAGAACAAGAGAGTTATATACGTACATGGTTGGAGGAAAGGATTGGTTTCAAGGCTGATTTTAAAATCTCGTT
TTACCCGGGAAAGTTTTCAAAAGAAAGGCGCAGCATATTTCCTGCTGGTGACACTTCTCAATTCATACCGTCAAAAGATG
CAGACATTGCTATTCTTGAAGAGCCTGAACATCTCAACTGGTATCACCACGGCAAGCGTTGGACTGATAAATTCAACCAT
GTTGTTGGAATTGTCCACACAAACTACTTAGAGTACATCAAGAGGGAGAAGCATGGTGCTATCCAAGCATTTTTTGTGAA
CCATGTAAACAATTGGGTCACACGAGCATATTGCGACAAGGTTCTTCGCCTCTCTGGAGCAACACAAGATCTGCCAAAAT
CTGTTATATGCAATGTCCATGGTGTCAATCCCAAGTTCCTTATGATTGGGGAAAAAATTGCTGAGGAGAGTACCCGTGGG
GAACAAGCTTTCTCAAAAGGCGCATACTTCTTAGGAAAAATGGTGTGGGCTAAAGGCTACAGAGAACTAATAGATCTGAT
GGCTAAACACAAAAGCGACCTCGGGAGCTTCAATTTAGATGTGTACGGAAACGGTGAAGATGCAGTCGAAGTCCAACGTG
CAGCACAGAAACTCGATTTGAATCTCAATTTCCTCAAAGGAAGGGACCATGCGGACGATGCTCTTCACAAGTACAAAGTG
TTCATAAACCCGAGCATCAGCGATGTTCTATGCACAGCAACCGCGGAAGCACTAGCCATGGGGAAGTTCGTGGTGTGTGC
AGACCATCCTTCAAACGAGTTCTTCAGATCATTCCCAAACTGTCTAACCTACAAAACATCCGAAGACTTTGTGAACAAAG
TGAAAGAAGCAATGTCGAAAGAGCCGTTACCGCTCACCCCTGAGCAGATGTACAATCTTTCTTGGGAAGCAGCGACACAG
AGATTCATGGAGTATTCGGATCTCGATAAGATCTTAAACGATGAAGACGGAGGAAAAAGGATGAGAAAATCAAGATCGGT
TCCGAGCTTTGACGAGGTGATCGATGGAGGATTGGCGTTCACACACTATGTTCTCACAGGGAATGATTTCTTGAGACTAT
GCAGTGGAGCAACACCAAAAACAAAAGACTATGATAAGCAACATTGCAAGGATCTGAAACTTGTTCCACCTCAAGCTCAC
AAGCCAGTCTATGGCTGGTAG