Details for Kale Locus Bo5g136220

Position : C5 ( 5`- 42094391 .. 42096428 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136220

Protein [Map View]
MEMDLNAQVKKACFLQRLKDFPSKLKDGVTKRIKHVQKFGKDDPRRIIHSIKVGLSLTLVSMLYYVRPLYNSFGVSGMWA
ILTVVVVSEFTVGGTLSKGLNRAFATLIAGALGVGAVHLARLCGHKGEPIVLGILVFSLGAAATFSRFFPRIKQRYDYGA
LIFILTFSMVAVSGYRTDEILVIAYQRLSTILIGGTICILVSIFVFPVWAGEDLHKMVANNIIKLANSIEGFDGEYFPSS
EKTSKETNSSVREYKSILTSKSTEDTLANLARWEPGHGRFRLRHPWTKYLKIAGLVRQCAIHFEVLNGYVLSDAKAPQDF
ISKIQEPCSIMSREAGEALKDIAKSIKTMSRYHVCVNTHIKNSKNAIENLRLALKLSFPETEKDLLEIIPGVTMASTLID
IVSYVEKISEAVDEFSVLAHFKENLDPKLSPELGQHHLLHKGTVKPVLEGDNEEECNNSPHVVIAVHDEQPPTVNENNVN
LGAEKTTVVV*

DNA
ATGGAAATGGATTTGAATGCTCAAGTGAAGAAGGCATGTTTCTTGCAAAGGCTTAAGGATTTCCCTAGCAAGCTCAAAGA
CGGTGTCACCAAGCGCATAAAGCATGTGCAAAAGTTTGGGAAAGATGACCCAAGAAGGATCATACATTCCATAAAAGTGG
GACTTTCTCTCACATTAGTTTCAATGTTGTACTATGTAAGGCCACTCTATAATAGCTTTGGGGTTTCGGGTATGTGGGCA
ATACTAACCGTAGTCGTGGTCTCCGAGTTCACTGTTGGTGGGACACTTTCAAAAGGTTTAAACAGAGCTTTCGCAACATT
AATAGCCGGTGCCTTAGGGGTTGGTGCAGTACACCTTGCTCGATTGTGTGGACACAAAGGAGAGCCTATTGTTCTTGGGA
TATTAGTGTTCTCACTAGGTGCAGCTGCGACATTTTCGCGGTTTTTTCCAAGGATTAAACAGAGATATGACTATGGTGCC
TTGATATTCATACTTACATTTAGCATGGTTGCTGTTTCGGGGTACCGTACAGATGAAATATTGGTTATTGCATATCAAAG
ACTATCGACTATTCTCATTGGTGGAACAATATGCATCCTTGTGTCGATCTTCGTTTTTCCTGTATGGGCAGGCGAAGATC
TTCACAAGATGGTTGCTAACAACATTATCAAACTCGCTAACTCCATAGAAGGTTTCGACGGTGAATATTTTCCATCATCG
GAGAAGACTTCAAAGGAGACAAACTCGAGCGTTCGAGAATACAAAAGCATTCTAACATCAAAAAGCACTGAAGATACTTT
GGCGAATCTTGCAAGATGGGAACCAGGACATGGCCGATTCAGGTTACGCCATCCATGGACAAAGTACTTAAAGATCGCAG
GACTCGTTCGCCAATGCGCCATTCATTTCGAAGTTCTCAATGGCTATGTTCTCTCTGACGCTAAGGCACCGCAAGACTTC
ATAAGCAAGATTCAAGAGCCATGCTCGATTATGAGCAGAGAAGCTGGCGAAGCCCTAAAAGACATAGCCAAATCTATCAA
AACAATGAGCAGATACCATGTTTGTGTGAATACACACATTAAAAACTCCAAAAATGCCATAGAAAACCTAAGGCTTGCAC
TCAAATTATCTTTCCCGGAGACAGAGAAAGATCTCTTGGAGATCATTCCAGGAGTCACAATGGCGTCAACATTGATCGAC
ATCGTGAGTTATGTCGAGAAGATCTCTGAGGCTGTGGACGAATTTTCAGTTCTGGCACACTTTAAAGAGAATCTGGATCC
AAAATTATCACCGGAGTTAGGACAACATCACCTACTTCACAAGGGAACTGTAAAGCCTGTTCTAGAGGGTGACAACGAGG
AAGAATGCAATAACTCTCCTCATGTTGTTATCGCAGTCCATGATGAACAGCCACCAACAGTCAACGAAAATAATGTTAAT
TTGGGAGCAGAGAAGACGACAGTTGTCGTGTAA