Details for Kale Locus Bo5g136210

Position : C5 ( 5`- 42086121 .. 42086744 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136210

Protein [Map View]
MNTRVRYDPSQISRQTKPSDTPSSSPSRSHRRHPLLQRSLSSPSPTATCGGSTPAEFCGGTTASCAAVCCCCPCGLVNLL
VLAVYKVPRGICRRALRIRRRKHLVKNRILPPLPANGRVFQNSEFAIHPVDSNDVSDEDDDDFLDLKYFGKSAAAGLTTD
YETDEDDEAVLALEKEMWNRFYGAGFWRSPSQRESVSSPRGSKSFSL*

DNA
ATGAATACGAGGGTACGTTACGATCCGAGCCAAATCTCGAGGCAGACGAAACCGTCTGACACTCCATCGTCATCTCCGTC
GCGTAGCCACCGGAGACACCCTCTCCTCCAGAGAAGCCTCTCCTCTCCTTCTCCGACGGCCACTTGCGGTGGATCCACTC
CCGCCGAGTTCTGCGGCGGTACGACGGCGAGTTGCGCCGCCGTGTGCTGCTGCTGTCCCTGCGGACTCGTCAACCTCCTC
GTCCTCGCGGTCTACAAAGTCCCCCGCGGAATCTGCCGTCGCGCGTTACGTATTCGCCGCCGTAAACATCTCGTCAAAAA
CAGGATCCTTCCGCCGCTTCCGGCCAACGGGAGAGTGTTCCAGAACTCGGAGTTCGCGATCCATCCGGTGGATAGCAACG
ACGTCTCTGACGAGGATGATGATGATTTCTTGGATCTTAAATACTTCGGAAAATCAGCTGCGGCGGGGCTCACGACGGAC
TATGAGACCGATGAGGACGATGAGGCGGTGTTGGCGTTGGAGAAAGAGATGTGGAACAGGTTTTACGGTGCAGGATTCTG
GAGAAGTCCGTCGCAGAGAGAATCTGTGTCGTCTCCGAGAGGTTCAAAGTCTTTTTCGTTATAG