Details for Kale Locus Bo5g136200

Position : C5 ( 5`- 42081337 .. 42083189 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136200

Protein [Map View]
MGRCIYGCSAVTFFFSFFLLVTASSLPRNLEPVHHNKTGSGQINSNSVLVALLDSRYTELAELVEKALLLQKLEDAVGRH
NITIFAPRNEALERDLDPDFKRFLLQPGNLRSLQTLLLSHIIPTRVGSNQWPEENSGRVKHLTLGSDQVLHLSKAKGNGK
RLVNSAVITRPDDLTRPDGLIHGIERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEVDPRTNRLKKSAATAAVPAGSPPV
LPIQSAMAPGPSLAPAPAPGPGGPRHHFNGEAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPN
DEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEESMYNSVRRFGKVNYETLRFPHKVAAKEADGSVKFGSGDRSAYLFDP
DIYTDGRISVQGIDGVLFPEEEGTVKKQTSPVKKVVQPRRGKLLEVACRMLGAIGKDSYLSTC*

DNA
ATGGGTCGCTGCATCTATGGTTGCTCCGCAGTAACTTTCTTCTTCTCCTTCTTCCTCCTCGTCACTGCATCGTCTCTGCC
ACGGAACCTCGAACCGGTTCACCACAACAAAACCGGGTCCGGTCAGATAAACTCAAACTCAGTCCTCGTCGCTCTCCTCG
ACTCTCGTTACACCGAGCTCGCGGAGCTCGTCGAGAAAGCTCTCCTCCTCCAGAAACTCGAAGACGCCGTCGGCCGTCAC
AATATTACCATTTTCGCCCCTCGCAACGAGGCTCTGGAGCGTGACCTCGACCCGGATTTCAAACGGTTCTTGCTCCAACC
AGGTAACCTCAGATCCCTCCAAACGCTACTCTTGTCCCACATTATCCCCACCCGAGTCGGATCCAACCAATGGCCCGAGG
AGAATTCGGGTCGGGTCAAGCACCTCACGCTGGGGAGCGACCAAGTGCTGCATTTGAGCAAAGCCAAAGGAAACGGGAAG
AGGCTAGTGAACTCCGCCGTGATCACCCGACCCGATGATTTGACCCGACCCGACGGGTTGATCCACGGAATCGAGCGGCT
TTTAATCCCCCGCTCCGTCCAAGAAGATTTCAACCGGCGGAGAAATCTCCGGTCGATCTCCGCCGTGTTACCGGAAGGAG
CTCCGGAGGTCGATCCGAGAACAAACCGTCTCAAGAAATCCGCCGCCACCGCCGCGGTACCAGCCGGATCTCCGCCGGTG
CTCCCGATCCAATCCGCCATGGCTCCAGGTCCGTCGCTAGCTCCAGCACCGGCTCCGGGACCCGGAGGTCCACGTCACCA
CTTCAACGGCGAGGCTCAGGTCAAAGATTTCATCCACACGCTGTTGCATTACGGCGGATACAACGAGATGGCGGATATCC
TCGTGAATCTGACGTCGCTCGCGACGGAGATGGGACGATTGGTATCGGAAGGGTACGTTCTCACGGTGTTGGCTCCCAAC
GACGAAGCCATGGCGAAGCTGACGACGGATCAGCTGAGCGAGCCCGGAGCTCCAGAGCAGATCGTGTACTACCACATTAT
ACCGGAGTATCAGACGGAGGAGAGTATGTATAATTCGGTTAGGAGGTTTGGGAAGGTGAACTATGAAACGCTGCGTTTTC
CTCATAAGGTTGCCGCGAAGGAAGCTGATGGTTCGGTTAAGTTCGGTTCTGGTGACCGGTCTGCGTACTTGTTTGATCCG
GATATTTACACGGACGGTCGGATTTCGGTTCAAGGGATTGATGGTGTTTTGTTCCCTGAGGAGGAAGGGACGGTTAAGAA
ACAGACTAGTCCGGTTAAGAAAGTTGTTCAACCGAGAAGAGGGAAGTTGCTGGAAGTAGCATGTCGAATGCTTGGAGCTA
TTGGCAAAGACTCGTATTTAAGCACATGCTGA