Details for Kale Locus Bo5g135150

Position : C5 ( 5`- 42042183 .. 42043227 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135150

Protein [Map View]
MYLSLAQSCPTSSSSHLSLSLRLRDQPLSQRNLKVSYHMANFDGPGFAMVDGYWIQTKAIDVESSTDISPYLSRLLEDCV
WNGNRAIVFDLYWDVKSLDAKSEWRLSSVKLSTKNFCLFLRLPNPFTDNLKDLYRFFASKFVTFVGVQIEEDLVLLKENH
GIVIRSSLEIGKLAAKARGTPIVEFLGTRELAHKILWYDMSRLDSIQSKWDEAGGNDRLEAAAIEGWLIYNVYDQLQQ*

DNA
ATGTATCTTTCACTCGCGCAGTCATGTCCTACTTCGTCTTCTTCTCATCTTTCTCTCTCTCTCCGTTTACGAGATCAACC
TTTGTCGCAGCGAAATCTCAAAGTTTCCTATCACATGGCCAACTTTGATGGGCCAGGGTTCGCTATGGTCGACGGTTACT
GGATCCAGACCAAAGCCATCGACGTCGAATCCTCAACCGACATCTCTCCATACCTCTCCCGTCTCCTAGAAGACTGCGTC
TGGAACGGTAACAGAGCCATAGTCTTCGACCTCTACTGGGACGTCAAATCTCTCGACGCAAAGTCAGAGTGGCGTCTCTC
CTCTGTGAAGCTAAGCACCAAGAACTTCTGCCTCTTCCTCCGCCTCCCAAACCCCTTCACCGACAATCTCAAGGATCTCT
ACCGCTTCTTCGCTTCCAAGTTCGTCACGTTCGTCGGCGTCCAGATCGAGGAAGACCTTGTTCTGCTTAAGGAGAATCAC
GGGATTGTGATCAGAAGCTCCTTGGAGATTGGGAAGTTAGCTGCTAAAGCTAGAGGGACTCCGATCGTTGAGTTTCTTGG
GACGAGAGAGTTGGCTCATAAGATACTTTGGTATGATATGAGCAGGCTTGATTCGATTCAGTCTAAGTGGGATGAAGCTG
GGGGTAATGATCGTCTCGAAGCTGCTGCTATTGAAGGTTGGCTTATTTACAATGTATATGATCAGTTGCAGCAGTGA