Details for Kale Locus Bo5g135140

Position : C5 ( 5`- 42040163 .. 42041320 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135140

Protein [Map View]
MSRFFLAISCFLFISTIVRATDVKYCDDNAQYQVKVQGVDISPYPIARGEQVTFSLASNTDNVISKGKLVIEVSYFGWHI
HSETHDLCDETNCPVAIGDFLVAHSQVMPGYTPPGPYSLKMKMLDGHKELTCIKFSFDIGFGSSVADM*

DNA
ATGTCGAGATTTTTTCTGGCTATCTCTTGTTTTCTGTTCATCTCAACGATTGTCAGAGCCACCGATGTCAAGTACTGCGA
TGATAACGCACAGTATCAAGTAAAGGTTCAAGGAGTTGATATATCGCCTTATCCTATTGCTCGAGGCGAGCAAGTTACTT
TCAGCCTTGCTTCTAACACAGACAATGTGATCTCAAAGGGAAAGCTGGTGATCGAAGTTTCATACTTTGGATGGCATATT
CATTCTGAGACACATGATCTTTGTGATGAGACCAACTGTCCTGTCGCAATTGGAGACTTCTTGGTAGCACACTCGCAAGT
TATGCCCGGTTATACTCCTCCTGGTCCATACTCACTTAAAATGAAGATGCTTGATGGGCACAAGGAGTTAACCTGCATCA
AATTCTCATTTGACATTGGATTTGGATCATCAGTGGCCGACATGTAG