Details for Kale Locus Bo5g135130

Position : C5 ( 5`- 42036260 .. 42037681 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135130

Protein [Map View]
MARFLLLLCFLLAAALTSSLTSAGDDNHVYSPCSDSTVAVGDGFTFGIAFAAKDSFLGTNRSVQYSPCDRRRLSLNGNSE
LAVFRPKVDEITLLTINTSSSSSSYRPDSSKGYMVAFAGAKYAARSVPIMVADNDHVVTSFTLVLEFQKGRLENLFWKKD
GCSKCTGDAKFVCLNKEECAIKRQSCTNQGGQVDCSLGIQLAFSGTDKHYTALNSWYEVANLKQYSLYGLYSNLKDSLSS
QFSNIF*

DNA
ATGGCTAGATTCCTCCTCCTCCTCTGTTTCCTCCTCGCGGCAGCGCTTACGTCATCCCTGACATCCGCCGGTGACGACAA
CCATGTCTACTCGCCTTGCTCAGATTCCACCGTCGCGGTCGGCGATGGATTCACTTTCGGAATTGCCTTCGCGGCGAAAG
ACTCTTTCCTTGGCACCAACCGTTCCGTTCAGTACTCTCCTTGCGATCGTCGCCGCCTCTCGCTCAACGGAAACTCTGAG
CTGGCCGTATTCAGACCTAAAGTCGATGAGATCACGCTCCTCACCATCAATACCTCTTCAAGTTCCTCTAGTTACCGCCC
GGATTCCTCAAAGGGATATATGGTAGCGTTCGCTGGTGCAAAATACGCTGCGAGATCAGTTCCAATTATGGTTGCAGACA
ACGATCACGTCGTCACAAGCTTCACCCTTGTTCTTGAGTTCCAAAAGGGCAGGCTTGAGAACTTGTTCTGGAAGAAAGAC
GGATGCTCCAAATGCACTGGAGACGCGAAGTTCGTGTGCCTCAACAAAGAGGAATGCGCAATCAAAAGACAAAGCTGCAC
GAACCAAGGAGGGCAAGTGGATTGTAGCTTGGGGATCCAGTTGGCGTTTTCAGGCACGGATAAGCATTACACCGCGTTGA
ACTCTTGGTACGAGGTTGCTAATCTGAAGCAGTACTCGCTTTATGGCCTCTACTCTAATCTTAAGGATTCACTAAGCAGC
CAGTTCAGTAACATCTTCTGA