Details for Kale Locus Bo5g135100

Position : C5 ( 5`- 42022001 .. 42025266 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135100

Protein [Map View]
MASMMQPQIILLKEGTDTSQGKAQLLSNINAVTAVGDVVRTTLGPRGMDKLIHDDKGSVTISNDGATIMKLLDIVHPAAK
ILVDIAKSQDSEVGDGTTTVVLLAAEFLKEAKPFVEDGVHSQNLIRSYRTASALAIEKVKELAVSIEGKSVEEKKGLLAK
CAATTLSSKLIGGEKEFFATMVVDAVMAIGDDDRLNLIGIKKVPGGNMRDSFLVDGVAFKKTFSYAGFEQQPKKFDNPKI
LLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVESGAKVVLSRLAIGDLATQYFADRDIFCAGRVAEE
DLNRVAAAAGGTIQTSVNNIIPEVLGTCEIFEEKQVGGERFNIFSGCPSGRTATIVLRGGADQFIEEAERSLHDAIMIVR
RAVKNSTVVPGGGAIDMEISKYLRQHSRTIAGKSQLFINSYAKALEVIPRQLCDNAGFDATDVLNKLRQKHAMQSGEGAS
YGVDINTGGIADSFANFVWEPAVVKINAINAATEAACLILSVDETVKNPKSESAQGDAAAGAMGRGRGGGRGRGMRRR*

DNA
ATGGCGTCGATGATGCAACCGCAAATCATACTGCTGAAGGAAGGCACAGACACTTCTCAGGGGAAAGCTCAGCTTCTGAG
CAACATCAACGCCGTCACGGCGGTTGGCGACGTGGTTCGAACCACGCTCGGTCCTCGAGGGATGGACAAGCTCATCCACG
ACGATAAGGGATCCGTCACCATTTCCAACGACGGCGCTACTATTATGAAGCTCCTCGACATCGTACATCCCGCCGCTAAG
ATCCTCGTCGATATCGCCAAGTCTCAGGACTCAGAGGTTGGTGATGGGACGACGACGGTTGTTCTTCTTGCTGCTGAGTT
TTTGAAGGAAGCTAAGCCGTTTGTTGAGGATGGTGTTCACTCTCAGAATTTGATTAGGAGTTATCGCACTGCAAGCGCTT
TGGCAATTGAGAAGGTGAAAGAACTCGCTGTTAGCATTGAGGGGAAGAGTGTGGAGGAGAAGAAAGGTTTGTTGGCTAAA
TGCGCTGCTACCACTCTTTCCTCTAAGCTTATTGGTGGAGAAAAGGAGTTTTTCGCTACTATGGTTGTTGATGCTGTTAT
GGCCATTGGGGATGACGACAGGCTCAATTTGATTGGGATCAAAAAGGTTCCTGGTGGTAACATGCGGGACTCTTTCCTAG
TTGATGGTGTGGCCTTCAAAAAGACTTTCTCGTATGCGGGTTTTGAACAGCAGCCGAAGAAGTTTGATAACCCCAAAATC
CTACTGCTTAACATTGAACTGGAGTTGAAATCTGAGAAGGAAAACGCTGAGATTAGGCTGTCAGATCCATCGCAGTACCA
GTCAATAGTTGATGCAGAGTGGAATATCATTTATGACAAGCTAGACAAATGTGTCGAAAGTGGAGCTAAGGTTGTTCTTT
CCCGATTGGCTATTGGTGATCTAGCTACTCAGTATTTTGCTGATCGTGATATTTTCTGCGCTGGCCGTGTAGCAGAAGAA
GATCTTAATCGCGTGGCTGCTGCGGCCGGAGGAACAATTCAGACAAGTGTTAACAACATAATACCCGAGGTTCTCGGAAC
TTGTGAGATTTTTGAGGAAAAACAAGTTGGTGGGGAGAGGTTTAACATATTCAGTGGTTGCCCTTCAGGACGTACAGCAA
CTATTGTCCTCCGTGGTGGCGCTGATCAGTTCATCGAAGAAGCTGAGCGGAGTTTGCATGATGCTATTATGATTGTGAGA
AGAGCTGTGAAAAACTCAACTGTTGTGCCTGGAGGTGGAGCTATTGATATGGAGATAAGCAAATACCTGAGGCAGCATTC
ACGAACAATTGCTGGGAAGTCACAGCTTTTCATCAACTCGTATGCAAAGGCCCTGGAGGTTATTCCACGACAGCTATGTG
ACAATGCTGGATTTGATGCAACTGATGTCCTAAATAAATTAAGACAGAAACACGCCATGCAAAGCGGTGAAGGAGCTTCT
TACGGAGTAGACATCAACACTGGTGGAATAGCGGACTCATTTGCTAACTTCGTGTGGGAACCTGCAGTTGTGAAGATTAA
TGCTATAAACGCTGCAACTGAGGCAGCGTGCCTTATCCTAAGTGTGGATGAAACCGTGAAGAACCCTAAATCTGAGAGCG
CACAGGGAGATGCTGCCGCTGGAGCTATGGGAAGAGGACGCGGTGGAGGTCGTGGCCGTGGTATGCGCAGGCGTTAA