Details for Kale Locus Bo5g135090

Position : C5 ( 5`- 42019938 .. 42021716 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135090

Protein [Map View]
MDHEEDEIEIPNYFICPISLEIMKDPVTTVSGITYDRQSIVQWLEKVPSCPVTKQPLPLDSDLTPNHMLRRLIQHWCVEN
ATRGVVRIPTPRAPPGKPNLIEEIKNLKKFGQEALGKEDTLKKLEVLAMEGERNRRLMCEEGVHKSLILFVVKYTREEEE
EEGQRRIKGNLDESLRLLHLIGVPLNEARTILIENERILESLTLVLNQQDFMNKAYTIVLLRNLTENTSSHIVERLSAEI
FKGIIGFLKDEVSSSNRVNPSVCATVQPSNSRVRNKAPSKLDHSVVIKQAVTAALMILLETSSWSRNRTILVDLGAVSEL
IELEISSIGEKRTTELVLGILSRLCCCANGRAEFLAHRGGIAIVTKRLLRVSAAADDRAISILSSVSKYSPESEVVEEMA
SVRTVKKLCSVLSIDCSLSLKEKAKEILRDHIDEWKKFPCIDVALVTKLLSSSPKDLLTEYYSRVGV*

DNA
ATGGATCATGAAGAGGATGAGATCGAGATCCCTAACTACTTTATCTGCCCAATCTCACTAGAAATTATGAAAGATCCAGT
CACGACCGTTTCTGGCATCACTTACGACCGTCAAAGCATCGTTCAGTGGCTAGAGAAGGTCCCATCATGTCCCGTGACGA
AGCAGCCTCTTCCTCTAGACTCAGATCTTACGCCTAACCATATGCTTCGCCGTCTCATCCAACACTGGTGCGTCGAGAAT
GCAACGCGTGGTGTTGTTAGAATCCCTACTCCCAGAGCTCCTCCAGGGAAGCCTAACTTAATCGAGGAGATCAAGAATCT
CAAAAAGTTTGGACAAGAAGCCTTAGGAAAAGAAGACACGTTAAAGAAGCTTGAAGTGTTAGCTATGGAGGGAGAGAGAA
ACAGGAGACTGATGTGTGAAGAAGGCGTACATAAGTCTTTGATCTTGTTCGTAGTCAAGTATACTCGTGAAGAAGAAGAG
GAGGAGGGACAACGTCGTATCAAAGGGAACCTAGATGAGTCTCTACGTCTTCTTCACTTGATCGGTGTTCCGTTAAATGA
AGCAAGAACAATCTTGATCGAAAATGAGCGGATCTTGGAATCGTTGACTTTGGTCTTAAACCAACAAGACTTCATGAACA
AGGCTTATACTATTGTCCTCTTGAGGAACCTAACTGAAAACACATCCTCTCATATCGTCGAGAGATTGAGTGCTGAGATA
TTCAAAGGCATCATAGGGTTTCTCAAGGACGAAGTAAGTAGTTCCAATCGCGTAAACCCTAGCGTGTGTGCTACGGTACA
ACCATCAAACTCTAGAGTGAGAAACAAGGCACCATCGAAACTAGATCATAGCGTGGTTATTAAACAAGCTGTGACCGCTG
CGCTGATGATTCTTCTAGAGACCTCTTCTTGGAGCCGGAATCGTACCATCCTTGTGGATCTCGGTGCGGTTTCGGAACTC
ATCGAACTCGAGATAAGCTCAATTGGCGAGAAGAGAACCACGGAACTTGTGTTGGGAATCTTGTCTCGTTTATGTTGTTG
CGCAAACGGTAGAGCTGAGTTTCTTGCACATAGAGGCGGAATCGCGATTGTGACAAAGCGGTTGTTGAGGGTTTCGGCAG
CAGCGGACGATAGAGCTATCTCTATACTAAGCTCAGTGTCCAAATACTCGCCGGAAAGCGAAGTGGTGGAAGAGATGGCT
AGCGTAAGGACAGTAAAGAAGCTTTGTTCTGTCCTAAGTATAGACTGTAGTTTAAGCTTGAAGGAGAAAGCGAAAGAGAT
ACTTAGAGATCATATTGATGAGTGGAAGAAGTTTCCATGCATTGACGTAGCTCTAGTTACTAAGCTTTTAAGCTCTTCAC
CCAAAGATCTACTCACCGAGTATTACTCACGAGTTGGTGTTTAG