Details for Kale Locus Bo5g135080

Position : C5 ( 5`- 42013651 .. 42015527 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135080

Protein [Map View]
MESPSKDLIQCCDCGCHSSPRSFHRSVKRRHDESNNPKVHIENECELLRETVTSQQQSIQELYDELEKERNAAASAADES
MNVMQRLQNEKAELQMELRQYKLYVGEKMEHDLQEMLALEELVNQREQTIMALTCEAQAYKHRMMSYGLTEGEAEGGKSG
NSSDGYDLTAYDYPPLKCNVVENHDPLGADVYVADDGKYPPVVSPLKSLDQRISEMETNPGFAELDGGFSGVKEKMVVGG
QSPRPQRHFRRMSTKEVRPDAYVESPKKVANVSSYTENVNAKDDDSSDIGGDDMSDRVYTIDSVHHGVTEQKLEAETSDG
MDLGDPDITKLYMRLQALEADRESMKQALVSMRTDKAQMVLLKEIAQHLSKEVVPQRRLPLRKASTGGPLPFTPVFKWIS
SFVSWRRKARRSKYMYGMSANNMGLQMLLEKVPRSRKWRCLRSTQV*

DNA
ATGGAGTCTCCTTCCAAAGATCTAATCCAATGCTGCGACTGTGGATGCCACTCCTCTCCACGCTCCTTCCACCGCTCCGT
GAAACGCAGACACGACGAATCCAACAACCCCAAAGTCCACATCGAGAACGAGTGCGAGCTCCTCCGAGAAACCGTCACCA
GCCAGCAGCAATCTATCCAGGAGCTCTACGACGAGCTCGAGAAGGAGAGGAACGCCGCGGCTTCGGCTGCGGACGAGTCC
ATGAACGTGATGCAGAGGCTGCAGAACGAGAAGGCAGAGCTTCAGATGGAGCTGAGGCAGTACAAGCTCTACGTTGGGGA
GAAGATGGAGCACGATTTGCAGGAGATGTTGGCGTTGGAGGAGTTGGTTAATCAGAGGGAGCAGACTATAATGGCGTTGA
CGTGCGAGGCTCAGGCTTATAAGCATAGGATGATGAGTTATGGGTTAACGGAGGGTGAAGCTGAAGGGGGCAAGAGTGGT
AACTCGAGTGATGGATATGATCTTACTGCTTATGATTATCCTCCTTTGAAGTGTAATGTAGTTGAGAATCATGATCCTCT
GGGAGCTGATGTATATGTTGCTGATGATGGGAAGTATCCGCCTGTTGTTTCGCCTTTGAAGAGTTTGGATCAGAGGATCA
GCGAGATGGAGACTAATCCTGGCTTTGCTGAGCTGGATGGTGGTTTCTCCGGTGTTAAGGAGAAGATGGTGGTTGGTGGT
CAGAGTCCAAGGCCTCAACGACATTTTAGGAGGATGTCTACTAAAGAAGTTAGGCCTGATGCTTATGTTGAGTCTCCTAA
GAAAGTGGCTAATGTCTCCTCATATACAGAGAATGTTAATGCTAAAGATGATGACTCTTCGGATATAGGAGGAGATGACA
TGAGTGATAGAGTTTACACCATTGACTCTGTTCATCACGGTGTAACTGAGCAAAAGCTTGAGGCTGAGACTTCTGATGGT
ATGGATCTTGGTGATCCTGATATAACGAAGCTGTACATGAGGCTTCAAGCACTGGAAGCTGACAGGGAATCGATGAAGCA
GGCGCTTGTTTCTATGAGGACTGACAAGGCTCAGATGGTGCTGTTGAAAGAGATTGCTCAACATTTGTCAAAGGAAGTTG
TTCCTCAAAGGAGGTTGCCTCTGAGGAAAGCATCCACCGGTGGGCCATTGCCTTTCACTCCTGTCTTTAAGTGGATCTCT
TCTTTTGTTTCCTGGAGAAGAAAGGCTCGTAGAAGCAAGTATATGTATGGGATGTCAGCAAACAACATGGGACTGCAAAT
GCTTCTAGAAAAGGTCCCTAGATCAAGGAAATGGCGATGCCTCAGGAGCACGCAAGTGTGA