Details for Kale Locus Bo5g135070

Position : C5 ( 5`- 42009548 .. 42011641 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135070

Protein [Map View]
MARQRPKQLEPNKIGSSKVGFEGEEEEGGWVFVKKQRVIIVLPSLPLPEPFIGEKPPATSYLQAERRDSVVADTREAARV
VVVPSLPLPEEFVLKKPETCQSLVELRDIIAADIRETTPLPRPKDFILQKAVTCQSQAELGDVVTDKHVTTPLQRVVPEP
FVLGKPATSQLQAELREANVHTMVPYVPVPEHRTLQTPETSQTQAEFRADKHEASLVHTVVPSLPVTEHITLQKPATSHS
QADLRTRKAALAHSVVSSLPVTEHITLQSQAEEMRKATLVHTVVPSLPVTEHAPLQKPATSKSLAELRAEETPKATLAHT
VVSSRSVTEHITLQKPATSKSQAELRSEETRKASLANTVVSSLPEYEHRTLQKPVTSQSQAEIRAKETLKATLLSPVGPK
LPVTEHRTLQKPVASQSQAELRAKETFKATRVQAVAPSLPVLDYCTLQKPATSHSQDELRAKTRKATLVHAVEPYLPVTG
HLTLQKPATSQSQAELRAKETPKATVVQAEMPSLPVLDYCTLQNPATHHPQAEPRDFVSDAQETADFQAVDKPERVMDRS
YTTRKAPGPRRSSQDCRMDSDRRMANQRSRRTGHNKPVRFPRVMCSSVVMDNEKLRVVNLEKKVEKAGGLNEWVGSIGLG
REFERMLRGQRMSKFQMANLTMEKLKQMGALAVGPRRKLIHAIRCVYHPHCLRASFN*

DNA
ATGGCGAGGCAAAGGCCGAAGCAGCTGGAGCCAAACAAGATTGGTTCTTCCAAGGTGGGTTTTGAAGGAGAAGAAGAAGA
AGGAGGTTGGGTTTTTGTTAAGAAGCAGAGAGTCATCATTGTCTTGCCTTCTCTTCCTCTACCTGAGCCTTTTATTGGGG
AGAAGCCTCCTGCAACTTCTTATCTTCAAGCTGAGCGTAGAGACTCTGTTGTTGCTGATACTCGAGAAGCTGCTCGTGTG
GTGGTGGTGCCTTCTCTTCCTCTACCTGAGGAATTCGTTTTGAAGAAGCCTGAGACTTGTCAGTCACTAGTTGAGTTGAG
AGACATTATTGCTGCAGATATACGTGAGACTACTCCTCTTCCTCGACCTAAAGATTTCATTTTGCAGAAGGCTGTAACTT
GTCAATCACAGGCTGAGTTAGGAGATGTAGTAACGGATAAGCATGTAACTACTCCTCTTCAGAGAGTGGTGCCTGAGCCT
TTTGTTTTGGGGAAGCCTGCAACTTCTCAGTTACAAGCTGAGTTAAGAGAGGCTAATGTTCACACAATGGTGCCTTATGT
TCCCGTACCTGAACATCGCACTTTGCAGACACCTGAAACTTCTCAAACGCAAGCTGAGTTTAGAGCAGATAAGCATGAAG
CGTCTCTTGTTCACACAGTGGTGCCTTCTCTTCCGGTAACTGAGCATATCACTTTGCAGAAGCCTGCAACTTCCCATTCA
CAAGCTGATTTAAGAACGCGCAAAGCTGCTCTTGCTCACTCTGTGGTGTCTTCTCTTCCGGTAACTGAACATATCACTTT
GCAATCACAAGCTGAGGAGATGCGCAAAGCTACTCTTGTTCACACTGTGGTGCCTTCTCTTCCGGTAACTGAACATGCCC
CTTTGCAGAAACCTGCAACTTCGAAATCACTAGCTGAGTTGAGAGCCGAGGAGACGCCCAAAGCTACTCTTGCTCACACT
GTGGTGTCTTCTCGTTCGGTAACTGAACATATCACTTTGCAGAAACCTGCAACTTCGAAATCACAGGCTGAGTTAAGATC
TGAGGAGACGCGCAAAGCTTCTCTTGCTAACACTGTAGTGTCTTCTCTTCCAGAGTATGAGCATCGCACTTTGCAGAAGC
CTGTAACTTCCCAGTCACAAGCTGAGATAAGAGCCAAGGAGACGCTCAAAGCTACTCTTCTTAGCCCTGTGGGGCCTAAA
CTTCCAGTAACAGAGCATCGCACTTTGCAGAAGCCTGTAGCTTCTCAGTCACAAGCTGAGCTAAGAGCCAAGGAGACGTT
CAAAGCTACTCGTGTTCAAGCAGTGGCGCCTTCTCTTCCTGTGCTTGACTATTGCACTTTGCAGAAGCCTGCAACTTCGC
ATTCACAAGATGAGTTAAGAGCCAAGACTCGCAAAGCTACTCTTGTTCACGCAGTGGAGCCTTATCTTCCAGTAACTGGG
CATCTCACTTTGCAGAAGCCTGCAACTTCCCAATCACAAGCTGAGCTAAGAGCCAAGGAGACGCCCAAAGCTACCGTAGT
TCAAGCAGAGATGCCTTCTCTTCCTGTGCTTGACTATTGCACTTTGCAGAATCCTGCAACTCATCACCCACAAGCTGAGC
CGAGAGACTTTGTATCAGATGCTCAGGAAACAGCTGATTTTCAAGCTGTAGACAAACCGGAGAGGGTGATGGATCGCAGT
TACACAACCAGGAAAGCTCCAGGTCCAAGGAGATCATCCCAAGATTGTAGGATGGATTCAGATAGAAGGATGGCAAACCA
AAGGAGCCGTCGTACAGGTCACAACAAGCCTGTAAGGTTTCCTAGAGTGATGTGCAGCTCTGTGGTTATGGACAACGAGA
AGCTGAGAGTGGTGAATCTAGAGAAGAAGGTTGAGAAAGCAGGAGGGTTGAACGAATGGGTAGGATCTATAGGATTGGGG
AGAGAGTTTGAGAGGATGCTGAGAGGACAGAGGATGAGTAAGTTTCAAATGGCGAATTTGACAATGGAGAAGCTTAAGCA
GATGGGTGCTTTAGCCGTTGGACCTAGAAGAAAGCTTATACATGCTATTCGTTGTGTCTATCACCCACATTGTCTTCGTG
CTTCCTTTAACTAA