Details for Kale Locus Bo5g135060

Position : C5 ( 5`- 42004615 .. 42008357 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135060

Protein [Map View]
MAMAIKDVAADDDIDASLPLLNSPSSGDRTSAIQTLGNIIVSIVGTGVLGLPYAFRVAGWFAGSLGVIIIGFATYYSMLL
LIQCRDKLESEEGQEDSKTYGDLGFKCMGTKGRYLTEFLIFTAQCGGSVAYLVFIGRNLSSIFSSYGLTMVSFILILVPI
EVALSWITSLSALSPFSIFADICNIIAMCFVVKENVEMVVGGDFSFSDRTAIASTVGGLPFAGGVAVFCFEGFAMTLALE
GSMRERESFPKLLGKVLAGITFVYVLFGFCGYMAYGDETKDIITLNLPNNWSAIAVQIGLCVGLTFTFPIMVHPLNEIIE
QKLKRIECLQKHRRHHHHHETSSVSKYVIFTTRMLLVVGLAGIASLVPGFGTFASLVGSTVCALISFVLPASYHLTLLGP
SLNLWNKSVDVFIVICGLLFAVYGTYNTVAGL*

DNA
ATGGCGATGGCGATCAAGGACGTGGCGGCGGACGACGATATCGATGCATCTCTTCCGCTACTGAATTCTCCTTCTTCCGG
GGACAGAACGTCGGCTATTCAGACGCTCGGAAACATTATAGTCTCTATCGTCGGTACAGGCGTCCTTGGCCTCCCTTACG
CATTTCGCGTCGCTGGATGGTTCGCTGGCTCTCTCGGCGTCATTATCATCGGTTTCGCAACATATTACTCCATGCTCCTC
CTCATTCAGTGCAGAGATAAGCTAGAATCAGAAGAAGGACAAGAAGATTCAAAAACGTATGGTGACTTAGGATTCAAATG
CATGGGAACAAAAGGTCGATACCTGACCGAGTTCCTCATATTCACTGCTCAATGCGGTGGATCAGTAGCGTATCTAGTGT
TCATAGGACGTAACCTCTCATCCATATTCAGCTCATATGGATTAACCATGGTCTCTTTCATCTTGATTCTGGTTCCAATC
GAGGTTGCGTTATCATGGATCACTTCTTTATCAGCTCTCTCGCCTTTCAGCATCTTTGCCGATATATGCAACATCATAGC
CATGTGTTTCGTCGTGAAAGAAAACGTGGAGATGGTGGTTGGTGGAGACTTCTCGTTTAGTGACAGAACAGCTATTGCGT
CTACCGTTGGTGGTTTACCGTTCGCAGGAGGAGTTGCTGTGTTTTGTTTTGAAGGTTTTGCAATGACGCTGGCTCTTGAA
GGGTCTATGAGGGAGAGAGAATCTTTCCCTAAGTTGTTAGGTAAAGTGCTTGCTGGGATTACGTTTGTCTACGTGTTGTT
TGGGTTTTGTGGTTATATGGCTTATGGAGATGAAACTAAGGATATCATCACGCTTAACCTCCCAAATAATTGGTCTGCCA
TCGCTGTGCAGATTGGCTTATGTGTGGGATTGACGTTTACATTCCCGATCATGGTACATCCGCTTAACGAGATCATAGAG
CAGAAACTGAAAAGGATCGAGTGCCTTCAAAAGCATCGTCGTCATCATCATCATCACGAGACAAGTTCAGTCTCCAAATA
TGTAATCTTCACCACGAGGATGCTTTTGGTGGTAGGACTCGCAGGAATCGCGTCCCTAGTCCCGGGGTTTGGTACATTTG
CATCTCTGGTTGGAAGTACAGTGTGTGCACTCATTTCATTTGTGTTACCTGCTTCCTATCACCTTACGCTGCTCGGTCCA
TCGCTAAATCTATGGAACAAATCTGTTGATGTGTTCATCGTGATTTGCGGGTTGCTCTTTGCTGTCTATGGTACATACAA
CACCGTCGCTGGATTGTAA