Details for Kale Locus Bo5g135050

Position : C5 ( 5`- 41973872 .. 41982837 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135050

Protein [Map View]
MVTPTPLDQQEDEEMLVPHSDVVEGPQPMEVAQPEAAAAAAAAAVENPPVEEPPTMKYTWTIPGFTRLNTRKHYSDVFVV
GGYKWRVLIFPKGNNVDNLSMYLDVADAANLPYGWSRFSQFGLAIVNQINSSYSIRKESQHQFNSRESDWGFTSFMPLSE
LYDPTRGYLVNDTVVIEAEVAVRKVLDYWSYDSKKETGFVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDAPT
ASIPLALQSLFYKLQYNDTSVATKELTKSFGWDTYDSFMQHDVQELNRVLCEKLEDKMKGTVVEGTIQKLFEGHHMNYIE
CINVDYKSTRKESFYDLQLDVKGCKDVYESFDKYVEVERLEGDNKYHAEGHDLQDAKKGVLFIEFPPVLQLQLKRFEYDF
MRDTMVKINDRYEFPLELDLDRDNRKYLSPDADKSVRNLYTLHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKE
DVKRALEEQYGGEEELPQNNPGFNNPPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAEHLRVRLKKEQEEKEDKKKY
KAQAHLFTTIKVARDEDITEQIGKNKYFDLVDHEKVKSFRIQKQTPFQLFKEEVAKEFGVPVELQRFWIWAKRQNYTYRP
NRPLLPHEELQTVELLREACNKTNNAELKLFLEIERGPEERPIPPPDKSSADILLFFKLYDPENAILRYVGRLMVKKSSK
PMDIVGQLNQMAGFAPDEEIELFEEIKFEPCVMCEHLDKKTSFRLSQIEDGDIICFQKPLSIQENECPYPDVPSFLAYVQ
NREVVRFRSLEKPKEDEFTMELSKLHTYDDVVQRLAEKLGLDDPSKIRLTSHNCYSQQPKPQPIKYRGVDHLSDMLAHYN
QTSDILYYEVLDIPLPELQGLKTLKVAFHHATKDEVVIHNIRLPKQSTVGDVINELKTKVELSHPDAELRLLEVFFHKIY
KIFSSTERIENINDQYWTLRAEEIPEEEKNIGPSDRLVHVYHFTKEAGQNQAQVQNFGEPFFLVIHEGETLEEIKSRIQK
KLHVPDEDFAKWKFASFSMGRPDYLQDTEVVYDRFQRKDVYGAWEQYLGLEHVDNAPKRAYAANQNRHAYEKPVRIYN*

DNA
ATGGTGACTCCAACGCCGCTTGATCAGCAAGAGGACGAGGAAATGCTCGTTCCGCATTCTGATGTGGTCGAGGGACCTCA
GCCCATGGAAGTTGCTCAACCTGAGGCTGCTGCTGCTGCTGCTGCTGCCGCTGTGGAGAATCCTCCAGTGGAGGAGCCTC
CCACTATGAAGTACACGTGGACTATACCAGGTTTCACTAGGCTGAACACCAGGAAGCATTACTCTGATGTATTTGTTGTT
GGAGGGTATAAATGGAGAGTATTGATTTTTCCCAAAGGAAACAATGTTGACAATTTGTCCATGTACTTGGATGTTGCTGA
CGCTGCGAATTTGCCCTACGGGTGGAGCAGATTTTCGCAGTTCGGCCTGGCTATAGTTAATCAAATCAACAGCAGCTATT
CCATCAGAAAAGAGAGTCAGCATCAATTCAATTCAAGAGAAAGCGACTGGGGGTTTACATCATTCATGCCTCTCAGCGAG
CTTTATGATCCCACTCGTGGATATTTAGTGAATGATACTGTTGTAATTGAAGCTGAAGTTGCTGTGCGGAAGGTCCTTGA
TTACTGGTCATATGACTCAAAAAAAGAGACTGGTTTTGTTGGACTAAAGAACCAAGGTGCTACCTGTTACATGAATTCTC
TCCTGCAAACGTTATACCACATACCTTATTTCAGAAAGGCTGTTTACCACATGCCAACAACTGAGAATGATGCACCTACG
GCGAGTATCCCATTGGCGCTCCAGAGTTTGTTTTACAAGCTTCAATATAATGACACCAGTGTAGCGACAAAGGAGCTGAC
CAAGTCGTTTGGTTGGGATACATATGATTCGTTCATGCAACATGATGTTCAAGAACTCAACCGAGTTCTCTGTGAAAAGC
TTGAGGACAAAATGAAGGGAACTGTTGTGGAGGGAACAATACAGAAGTTATTCGAGGGTCACCACATGAATTACATAGAG
TGCATCAATGTAGATTACAAATCTACACGGAAAGAATCATTCTATGACCTCCAGCTTGATGTTAAAGGCTGCAAAGATGT
ATATGAATCTTTTGACAAGTATGTTGAAGTTGAACGCCTTGAAGGTGACAACAAATACCATGCAGAAGGACATGATTTAC
AGGATGCAAAAAAGGGTGTTCTGTTTATAGAATTTCCACCCGTACTTCAACTTCAGCTCAAGAGGTTTGAATATGATTTT
ATGCGAGACACAATGGTGAAGATAAATGATCGATATGAGTTTCCTCTTGAACTGGATCTTGACAGAGATAATAGAAAGTA
TTTATCCCCTGATGCTGACAAGAGTGTCCGTAATCTATACACACTCCACAGTGTCTTAGTTCATAGTGGTGGAGTGCATG
GAGGCCACTATTATGCTTTTATTAGGCCAACTCTCTCAGACCAGTGGTATAAATTTGATGATGAACGGGTGACGAAGGAA
GATGTGAAAAGAGCGCTGGAAGAGCAATATGGTGGTGAAGAAGAGTTGCCGCAGAATAATCCCGGTTTCAATAACCCACC
TTTTAAATTCACAAAATACTCGAACGCGTACATGCTTGTTTATATTCGGGAAAGCGACAAGGATAAAATAATCTGCAACG
TTGATGAAAAAGACATTGCAGAACATTTACGGGTGAGGCTGAAAAAAGAACAAGAAGAAAAGGAAGATAAAAAAAAATAC
AAGGCTCAAGCTCACCTTTTCACGACAATCAAGGTCGCAAGAGATGAAGACATTACTGAGCAAATTGGAAAGAATAAATA
CTTTGATCTTGTTGATCATGAAAAAGTTAAGAGTTTCCGAATTCAGAAACAGACCCCCTTTCAACTATTTAAGGAAGAGG
TGGCCAAAGAATTTGGTGTCCCGGTTGAGCTACAGCGGTTCTGGATTTGGGCAAAGCGGCAGAACTATACTTATCGGCCC
AACCGCCCCCTATTACCTCATGAAGAATTACAGACGGTTGAACTTTTAAGAGAGGCATGTAACAAGACAAACAATGCTGA
ACTAAAGCTGTTTCTGGAAATAGAGCGCGGACCGGAGGAGCGTCCTATTCCTCCCCCAGACAAGTCATCTGCAGATATTC
TCCTTTTCTTTAAGCTCTATGACCCTGAGAATGCAATTCTAAGATATGTTGGTAGGCTCATGGTGAAAAAATCCAGTAAG
CCCATGGACATAGTAGGGCAATTGAATCAAATGGCTGGCTTTGCTCCTGATGAGGAAATAGAACTTTTTGAGGAAATAAA
GTTTGAACCTTGTGTCATGTGCGAACATCTGGATAAGAAGACTTCTTTCAGACTATCTCAAATTGAAGATGGAGATATCA
TATGCTTTCAGAAACCTCTTTCTATCCAGGAGAATGAATGTCCTTACCCGGATGTACCATCGTTTTTGGCGTATGTACAG
AATCGAGAGGTGGTGCGCTTTCGAAGTCTCGAAAAACCAAAAGAAGACGAGTTCACTATGGAGTTGTCAAAGCTGCACAC
GTATGATGATGTTGTCCAAAGATTAGCTGAGAAGCTTGGCCTTGATGATCCATCGAAAATTAGGCTTACTTCTCACAATT
GCTACTCCCAGCAACCCAAGCCCCAGCCTATTAAATACCGTGGAGTAGACCATCTTTCAGATATGTTAGCTCACTATAAT
CAGACGTCTGACATTTTGTATTATGAAGTTCTGGACATTCCTCTTCCAGAATTGCAAGGTCTTAAGACTCTGAAAGTAGC
TTTCCATCATGCCACAAAGGACGAGGTGGTAATCCACAATATCAGACTTCCTAAACAGAGTACTGTAGGAGATGTTATCA
ACGAACTTAAAACAAAGGTGGAGTTGTCGCATCCTGATGCAGAACTGAGGTTGCTGGAGGTGTTTTTCCACAAGATCTAC
AAGATCTTTTCATCTACGGAAAGAATTGAGAATATCAATGACCAGTACTGGACTTTACGAGCAGAGGAGATACCTGAGGA
AGAGAAGAATATTGGTCCCAGTGATCGATTAGTCCATGTGTACCATTTTACTAAAGAGGCCGGACAAAATCAAGCGCAAG
TACAAAATTTCGGCGAGCCGTTCTTTCTGGTAATCCACGAAGGTGAAACTTTAGAAGAAATCAAGTCCCGTATCCAAAAG
AAGCTCCATGTACCTGATGAGGACTTCGCCAAGTGGAAGTTTGCTTCTTTCTCAATGGGACGTCCCGACTACTTGCAGGA
CACAGAGGTCGTTTATGATCGCTTTCAGAGAAAGGATGTATATGGTGCCTGGGAGCAGTATCTTGGGTTGGAGCACGTTG
ATAATGCTCCTAAAAGGGCTTATGCTGCAAATCAGAACCGACACGCATATGAGAAGCCGGTGAGAATATACAATTAG