Details for Kale Locus Bo5g135010

Position : C5 ( 5`- 41958964 .. 41960990 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135010

Protein [Map View]
MDPPVSDPDKINNQKEAGPSFHCHLYDTQLVHKISLTFLPGLATACVDNTTGDIFKTPGSVAADVKQEMIEYLNHRSETF
VADHILLSSSSEIEPSSHDPYDVVSDFVDDFATSKRNLFSRVSGWLLSERREDNIDDFAQEMEVSGFWLNDHIEGIAQTL
LKNVDFKGLSHCEMKFQTRGELEEHVLRCGYRTMDCGNEGCNAVFCANQRESHDSVCPFKIIPCEQGCLESGGIMRREMD
RHCITVCTMKLVNCAFRGVGCLDDVRQCEVQQHYLDSVGSHLMCVLKGMYKEASLDDLKPRAEQILQLSTRLSEARNARA
LTNLVKEIDAKLGALVIKPKKEKKVLEEAEIKGKPETAVSLEQTVGEKTSEDEVVSREAVALADDAMVEEVGKKVSEAEI
AENINEEGESKAQKLFEMDEFVKEGVSNNSAADLSERTETKAPEVVVMDEDKEEEKNPETRTNETRGVKTNDVIDEEDNR
ETKISDKTESEALSRIVMDKEENEEGAETKQIRTNETKGVETEVNDVIEEENNKETKISAETKSEVPSRIAMENEEGAET
KQTRTNETRGVETEVNDVIEEENNRETKISDETKREAPSRIVIMDKEENEEGAETSSLTASASDEAEALSKSSEGFSKAQ
AETEPNFS*

DNA
ATGGATCCACCAGTGTCAGATCCTGACAAAATCAACAACCAGAAAGAAGCAGGACCTTCGTTCCACTGCCATCTCTACGA
CACACAACTCGTCCACAAGATCTCCCTCACTTTCCTCCCCGGCCTCGCCACCGCCTGCGTCGACAACACCACCGGAGACA
TCTTCAAGACCCCAGGCTCCGTCGCCGCCGACGTCAAACAAGAAATGATCGAGTACCTAAACCACAGAAGCGAGACCTTC
GTGGCCGACCACATCCTCCTCTCCTCATCGTCAGAGATCGAACCTTCCTCCCACGACCCTTACGACGTCGTATCAGACTT
CGTCGACGACTTCGCCACCTCCAAGAGGAACCTCTTCAGCCGCGTCTCCGGGTGGCTCCTCAGCGAGAGGAGGGAGGACA
ACATCGACGACTTCGCTCAGGAGATGGAGGTCAGCGGCTTCTGGCTGAATGATCACATCGAAGGAATAGCTCAGACGCTG
CTCAAGAACGTGGACTTCAAAGGCCTTTCTCATTGCGAGATGAAGTTTCAAACACGAGGAGAGCTTGAGGAGCACGTTTT
GAGGTGTGGTTATAGGACGATGGACTGCGGGAACGAAGGGTGTAATGCTGTCTTCTGCGCGAATCAGAGGGAGAGTCATG
ACTCCGTTTGCCCGTTTAAGATCATTCCGTGCGAGCAGGGGTGTTTGGAGAGTGGTGGTATCATGAGGCGTGAGATGGAT
AGGCATTGTATTACTGTGTGTACTATGAAGCTTGTGAACTGTGCGTTTCGTGGTGTTGGTTGTTTGGATGATGTGCGTCA
GTGTGAGGTTCAGCAGCATTATTTGGATAGTGTGGGGTCTCATTTGATGTGTGTTCTCAAAGGTATGTATAAAGAAGCGT
CTTTGGATGATCTCAAACCCCGAGCTGAGCAGATACTGCAGTTGTCTACGCGGTTGTCTGAAGCTCGGAATGCAAGAGCG
CTGACGAATCTCGTCAAGGAGATTGATGCAAAGCTGGGGGCTTTAGTGATCAAACCAAAGAAGGAGAAGAAAGTTTTAGA
AGAAGCTGAGATCAAAGGGAAACCAGAGACAGCTGTTTCATTGGAGCAAACCGTGGGAGAGAAAACTTCAGAAGATGAAG
TGGTTTCAAGAGAAGCGGTGGCTTTAGCAGATGATGCAATGGTGGAAGAAGTTGGGAAGAAAGTTTCAGAAGCTGAGATA
GCAGAGAATATTAACGAAGAAGGCGAATCAAAAGCTCAAAAGCTTTTTGAAATGGATGAGTTCGTCAAAGAAGGAGTCAG
CAACAACTCTGCAGCTGATTTGTCGGAGAGAACTGAAACCAAAGCTCCAGAAGTTGTGGTCATGGATGAAGATAAGGAAG
AGGAAAAGAATCCAGAGACAAGAACAAATGAAACCAGAGGTGTAAAGACTAATGACGTGATTGATGAAGAGGATAATAGA
GAGACAAAGATATCAGATAAAACCGAAAGCGAAGCTCTGTCACGAATAGTCATGGACAAGGAGGAGAATGAAGAGGGAGC
AGAGACAAAACAGATAAGAACAAATGAAACCAAAGGTGTAGAGACTGAAGTCAATGATGTGATTGAAGAAGAGAATAATA
AAGAGACAAAGATATCAGCTGAAACCAAAAGCGAAGTTCCCTCAAGAATAGCCATGGAGAATGAGGAGGGAGCAGAGACA
AAACAGACGAGAACAAATGAAACCAGAGGTGTAGAGACTGAAGTCAATGATGTGATTGAAGAAGAGAATAATAGAGAGAC
GAAGATATCAGATGAAACCAAAAGGGAAGCTCCCTCAAGAATAGTCATCATGGACAAGGAGGAGAATGAAGAAGGAGCTG
AGACGAGCAGCTTAACTGCTAGTGCTTCTGATGAGGCTGAAGCATTGTCAAAGAGCTCAGAAGGTTTCTCTAAAGCACAA
GCTGAAACCGAACCAAATTTTTCTTGA