Details for Kale Locus Bo5g135000

Position : C5 ( 5`- 41948625 .. 41955773 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g135000

Protein [Map View]
MAAPEDESSAQSQSSSAAAAAPTPPPPPSSAGDHYLAKCVLRPSVVLQVAYGYFRSRSSRDIVFGKETCIELAVIGEDGV
VESVCEQNVFGTIKDLAVIPQSNKPYSNSFQMGKDLLAVLSDSGKLSFLSFSNEMHRFSPIQHVQLSSPGNSRDQLGRML
TVDSSGLFLAVSAYHDCFALFSLSTSSMADIILKRIFYPSEDGGKASSEQAVSGTIWSMCFISKSFNESMDYDPVLAIVL
NRKGSLLNELVLLRWNVKEESVCLISEYVEAGALAHSIVEVPHSSGFAFLLRMGDALLMDLRDPQNPCCLVRTSLDFVPA
SLVEEQFLEESCRVQDGDDEGLFNVAACALLELRDYDPMFIDNESDNGKLSSKHVSSWTWEPEHNHNPRMIICLDDGEFF
MFELRYEDDGVKVNVSECLYKGLPCKEILWVEGEFLATFAEMADGTVFKVGTEKLHWMSSIQNIAPILDFSVVDDQNEKR
DQIFACCGVTPEGSLRIIRSGINVEKLLKTAPVYQGITGTWTVKMKLTDVYHSFLVLSFVEETRVLSVGLSFKDVTDSVG
FQPDVCTLACGLVADGLLVQIHRDAIRLCMPTVDAHADGIPVSSPFFSSWFPENLSISLGAVGENLIVVSTSNPCFLSIL
GVKSVSSQCCVIYEIQRVTLQYEVSCISIPQKYIGKKKPRASSLDDSCSKAAIPSNMERGYTFLIGTHKPSVEVVSFSEE
DGGGVRVLASGMVSLTNTMGTVISGCIPQDVRLVLVDQVYVLSGLRNGMLLRFEWPPFSHSSGHCKEEMDSVVSDLLLIA
TRRIGITPVFLVPFSDSLDSDIIALCDRPWLLQTARQSLSYTSISFQPSTHATPVCSSECPQGILFVAENSLHLVEMVHS
RRLNAQKFHLGGTPRKVLYHSESKLLIVMRTDLYDACTSDICCVDPLSGSVLSSYKLKPGETGKSMELVRVGNEQVLVVG
TSLSFGPAILPSGEAESTRGRLIILCLEHTHNSDSGSMTICSKAGSSSQRTSPFRDVVGCTTEQLSSSSLCSSPDDNSYD
GIKIDESETWHLRLACATTWPGMVLAICPYLDHFFLASAGNAFYVCGFPNDSPERMKRFAVGRTRFMITSLRTYFTRIVV
GDCRDGVLFYSYHEDVKKLHQIYCDPAQRLVGDCFLMDANSVAVSDRKGSIAILSCKDHSDFEYSNPESNLNLNCAYHMG
EIAMAIKKGCNIYKLPADDVLRSYGLSKSIDAADDTIIAGTLLGSIFVFAPISREEYELLEAVQAKLVVHPLTAPVLGND
HKEFRGRENPSQATKILDGDMLAQFLELTNRQQESVLSTPQPSSSTLKSSSKQCSSPPLMLHQVVQLLERVHYALH*

DNA
ATGGCGGCTCCGGAGGATGAATCTTCCGCTCAGTCTCAATCTTCCTCTGCCGCTGCGGCTGCTCCCACTCCTCCTCCTCC
TCCTTCCTCCGCCGGGGATCATTACCTCGCTAAGTGCGTCCTCCGCCCCAGCGTCGTTCTCCAGGTTGCTTATGGTTATT
TCCGCTCTCGCTCCTCCCGCGACATAGTTTTCGGCAAGGAGACCTGCATAGAGTTGGCGGTTATCGGTGAAGACGGGGTT
GTTGAATCGGTGTGTGAACAGAATGTATTTGGAACAATCAAGGATTTGGCTGTTATACCTCAGAGTAATAAACCATACTC
AAATAGCTTTCAGATGGGTAAAGACCTTTTGGCTGTTCTTTCTGATTCTGGAAAGCTCTCATTTCTCTCATTTAGCAATG
AAATGCATAGGTTCTCGCCGATACAACATGTTCAACTGTCTAGTCCAGGAAATTCGAGGGATCAACTTGGAAGAATGCTC
ACTGTAGATTCTAGCGGACTTTTTCTTGCTGTCAGTGCATATCATGATTGTTTTGCGCTATTTTCCCTCTCAACATCGTC
TATGGCTGATATTATTCTTAAGAGGATATTTTATCCTTCTGAAGACGGAGGGAAGGCTAGCTCTGAACAAGCAGTATCTG
GTACTATTTGGAGCATGTGTTTCATTTCTAAAAGTTTTAATGAATCCATGGATTATGACCCTGTTCTTGCCATCGTTTTG
AATAGGAAAGGGTCTCTCCTGAATGAGCTAGTTTTGTTGAGATGGAATGTCAAAGAGGAATCCGTTTGTCTAATATCAGA
GTATGTCGAAGCTGGAGCTCTAGCACATAGTATTGTCGAAGTTCCTCACTCCTCTGGATTCGCCTTTCTGTTAAGAATGG
GTGATGCGCTCTTAATGGATCTTAGGGATCCTCAAAACCCTTGCTGTTTGGTTAGGACATCCTTAGATTTTGTTCCCGCG
TCATTAGTTGAAGAGCAGTTTCTTGAAGAGTCGTGTAGAGTACAAGATGGAGACGATGAGGGTCTTTTTAATGTTGCTGC
ATGTGCTTTGTTAGAGCTCAGGGATTATGATCCCATGTTCATAGATAATGAAAGTGACAATGGAAAGTTGAGTTCCAAGC
ATGTCTCTTCATGGACTTGGGAGCCGGAGCATAATCATAATCCCCGGATGATTATTTGCTTAGATGATGGCGAATTTTTC
ATGTTTGAACTCAGATACGAAGATGATGGGGTTAAAGTTAATGTATCAGAGTGTTTATACAAAGGTCTACCGTGCAAGGA
AATATTATGGGTGGAAGGTGAGTTCCTGGCCACGTTCGCCGAAATGGCTGATGGAACGGTTTTCAAAGTGGGAACCGAGA
AGCTGCATTGGATGAGTTCCATTCAAAACATAGCTCCGATCTTGGATTTCTCAGTTGTGGATGACCAGAACGAGAAACGA
GACCAAATCTTCGCTTGCTGTGGCGTAACGCCTGAAGGATCTTTAAGAATTATCCGTAGTGGCATTAACGTAGAAAAGCT
TTTGAAAACCGCCCCTGTTTATCAAGGAATCACTGGTACTTGGACTGTTAAAATGAAGCTAACTGATGTGTACCATTCGT
TTCTTGTTCTGTCATTTGTTGAAGAGACCAGGGTCTTATCTGTTGGATTAAGTTTCAAAGATGTCACTGATTCAGTTGGT
TTCCAGCCTGATGTTTGCACCTTGGCGTGTGGACTCGTTGCCGATGGTTTGTTGGTTCAGATTCACCGAGATGCAATAAG
GCTGTGCATGCCCACCGTGGATGCTCATGCTGATGGCATTCCTGTTTCTTCACCGTTTTTCTCCTCTTGGTTTCCAGAAA
ATCTCAGTATCAGCTTGGGGGCAGTTGGTGAAAATCTGATAGTTGTGTCCACGTCTAACCCTTGTTTTCTGTCTATTCTC
GGGGTCAAATCAGTATCATCTCAGTGCTGCGTAATCTATGAGATTCAACGAGTAACATTGCAGTATGAAGTCTCCTGCAT
CTCAATTCCTCAAAAATATATTGGAAAAAAGAAACCACGCGCTTCTTCCCTGGATGATAGTTGTAGCAAAGCTGCGATTC
CTTCTAATATGGAGCGAGGCTATACGTTTCTGATTGGCACACATAAGCCTTCTGTTGAGGTCGTCTCCTTCTCAGAAGAA
GATGGTGGTGGTGTTAGAGTCCTTGCTTCTGGGATGGTGTCTCTAACAAATACAATGGGAACTGTTATCAGTGGATGTAT
TCCTCAAGATGTAAGACTCGTGTTAGTTGATCAAGTTTATGTCCTTTCTGGGTTAAGAAATGGAATGCTGCTACGTTTTG
AGTGGCCTCCCTTTTCACATTCATCCGGTCACTGTAAAGAAGAGATGGACAGTGTTGTGAGTGACCTTCTGTTAATTGCC
ACCCGACGTATCGGCATCACACCTGTTTTTCTGGTTCCGTTCAGTGATTCACTAGATTCAGACATCATAGCTCTTTGTGA
CAGGCCATGGTTGTTACAAACAGCTCGGCAAAGCCTTTCCTATACTTCCATCTCATTCCAACCTTCAACCCATGCAACTC
CTGTATGCTCGTCTGAATGCCCTCAAGGAATTCTTTTTGTTGCAGAGAACTCTTTACATCTGGTGGAGATGGTTCACAGC
AGACGACTTAATGCGCAAAAGTTTCACCTTGGAGGCACTCCGCGAAAGGTTCTTTACCATAGTGAAAGCAAACTATTGAT
TGTGATGAGAACTGATCTGTATGATGCGTGCACGTCTGATATATGCTGTGTGGACCCGCTAAGTGGGTCAGTGTTATCGT
CCTACAAGCTCAAACCTGGAGAAACTGGAAAGTCAATGGAGCTTGTACGTGTGGGAAACGAGCAGGTCCTTGTGGTTGGG
ACGAGTTTGTCTTTTGGTCCTGCTATACTACCCAGTGGTGAAGCTGAAAGTACAAGAGGACGATTAATCATTCTCTGCTT
AGAACACACTCACAACTCGGATAGTGGTTCAATGACAATCTGCTCAAAGGCTGGTTCATCTTCCCAACGCACATCGCCTT
TTCGTGATGTTGTGGGATGCACAACAGAGCAACTATCAAGCAGTAGTCTCTGCAGCAGTCCTGATGATAATAGCTATGAT
GGAATCAAAATTGATGAATCTGAAACATGGCATTTGAGATTGGCCTGTGCAACAACTTGGCCTGGAATGGTACTTGCGAT
CTGTCCATACCTTGATCATTTCTTCCTGGCGTCTGCTGGCAATGCTTTCTATGTATGTGGCTTTCCGAACGATAGTCCTG
AGAGAATGAAAAGGTTTGCAGTGGGAAGGACTCGTTTCATGATAACATCTCTGCGCACATACTTCACTAGAATTGTTGTT
GGGGATTGCCGTGATGGTGTTCTATTCTATTCTTATCACGAGGATGTGAAGAAACTTCACCAAATATATTGTGATCCAGC
ACAGCGGTTAGTTGGTGATTGCTTTCTAATGGATGCCAACTCTGTTGCTGTATCTGATCGCAAGGGGAGTATAGCTATCT
TGTCTTGCAAAGATCATTCAGACTTTGAATATTCAAATCCGGAGTCCAACCTGAATCTAAACTGTGCTTATCACATGGGT
GAGATTGCCATGGCTATCAAAAAGGGTTGCAACATTTACAAACTTCCAGCTGACGATGTGCTGCGAAGTTATGGTCTTAG
TAAAAGCATTGACGCAGCTGATGACACTATCATAGCCGGCACCCTATTGGGAAGTATATTCGTCTTTGCTCCGATTTCAA
GGGAGGAATATGAGCTCCTAGAAGCTGTCCAAGCAAAGCTCGTGGTCCATCCTCTGACTGCTCCTGTTCTTGGTAATGAT
CATAAGGAGTTCAGAGGTCGAGAGAATCCGTCCCAAGCGACAAAGATTCTGGATGGAGACATGCTTGCTCAGTTCTTGGA
GCTTACAAATAGACAGCAGGAGTCAGTTTTATCGACGCCTCAGCCATCCTCAAGCACATTAAAATCAAGTTCAAAGCAAT
GTTCTTCTCCGCCTCTCATGCTACACCAAGTTGTACAATTGCTAGAGCGTGTCCATTACGCTCTCCACTAG