Details for Kale Locus Bo5g134970

Position : C5 ( 5`- 41927096 .. 41938973 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134970

Protein [Map View]
MVAPSKKVASGKRNDSTKVFKSSKKPFKKTKDDVAARSEAMALQLEDVPDFPRGGGTSLSKTERKKIYEEVDAEFEAEER
VSKRSKGGKPKMKRNPSEVDELGSLFDGGLTGKRPRYANKITIKNISPGMKLLGVVTEVNQKDIVISLPGGLRGLVRASE
ALDFTDFGTEDDENELLRDIFSVGQLVPCFVLQLDDDKKEAGKRKIWLSLRLSLLHKGFSLDSFQSGMVVTASVKSVEDH
GYILHFGLPSITGFIKKSKDGNQELKTGQLIQGVVTNIDKERKIVSLSADPDSVAKCVTKDLSGMSFDLLIPGMMVNARV
QSVLENGILLGFLMYFTGTVDLFHLQNPMCNKSWKDEYTQTKMVNARILFMDPSTRAVGLTLNPHLVGNKVPPLHVSSGD
IFDEAKVVRVDKSGLLLELPSKPVSTPAYVSTYDAAEDEVKKLEKNFKEGNRIRVRILGLKHMEGLAIGTLKESAFEGPA
FSHSDVKPGMVTKAKIISVDTFGAIVQFPGGLKAMCPLQHMSEFEVTKPRKKFKVGAELIFRVLGCKSKRITVTCKKTLV
KSKLPILSSYADATEGLVTHGWITKIEKHGCFVRFYNGVQGFVARFELGLEPGSDPSSVFHVGEVVKCRVTSAVHGTRRI
NLSFMIKPTSVSEDDSIKLGSIVSGVIDSITPQAVTVHVKSKGLLKGTVSAEHLADHHDQAKLMISLLRPGFELDKLLII
DIDGNNLALSSKYSLIKLTEELPSDISQLQPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDDPRADLSESFFVGQ
SVRANIVDINQEKSRITLSLKQSSCASVDASFIQEYFLTDEKISDLQSSDNTESECSWVEKFSIGSLVKGTVHEQNDLGL
VVNFDNIDNVLGFIPQYHLGGATLEHGSVVEAVVLDISRAERLVDLSLRPELINNSTKEVSNNQSKKKRRRGISKELEVH
QRVSAVVEIVKEQYLILSIPEHGYTIGYASISDYNTQKLPVKQFSAGQSVVASVESLQNSLTSGRLLLLLDSVSGISDTP
HSKRTRNKSSCGVGSVVHAEITEIKPLEVRVNFGQSFRGRIHITEVDDVSTSEEPFSKFRVGQSVSARVIAKPWHTNIKK
SLWELSSKPAILRDSSELNGIQVREQLEFVNGERVRGYVYKVDKEWVWLTISRNVTAGVFILDTACDAQELEEFERRFPI
GKAVSGYVLTYNKEKKTAQLVQRPLLDIQKSIANGGGCKTDNLDNSIPGDDATLFIHEGDILGGRISKILPGVGGLRVQI
GPNVFGRVHFTEINDSWVSNPLDGFHEGQFVKCKVLEISNSSKGTLQIELSLRTSLDGMTSDQLSEASNNNVNICKRFER
IEDLSPDMAIQGYVKNTMSKGCFIMLSRKLDAKVLLSNLSDTFVKDPEKEFPVGKLVTGRVLNVESLSKRVEVTLKKGNA
GGQPKSESYDLKQFHVGDVISGSIKRVEPYGLFITIDKTSMVGLCHKSQLSDDRIEDVQARYEAGESVTAKILKLDEEKQ
RISLGMKSSYFMNDDDVKAQPPSEENAKEDSMECDPINDLKSGVLAAVGNFGFQETGSERQSGTSLVLAQVESRASIPAL
EVNLDDIEEAGFDNDQNEKLQGVDKDEKSKRREKQKDKEERERKIQAAEGRLLENHAPESADEFEKLVRSSPNSSFVWIK
YMAFMLSLADIEKARSIAERALRTINIREEDEKLNIWVAYFNLENEHGSPPEEAVKKVFERARQYCDPKKVYHALLGVYE
RTEQYKLADKLLDEMVKKFKQSCKVWLRKVQSHLKQDVEDIQSIVNRALLCLPRHKHIKFISQTAILEFKCGNADRGRSL
FEGVLREYPKRTDLWSVYLDQEIRLGEVDVIRSLFERAISLSLPPKKMKFLFKKFLEYEKSAGDEERVEYVKQRAMEYAD
STLA*

DNA
ATGGTGGCTCCGTCGAAAAAAGTTGCAAGTGGAAAACGTAATGACTCTACTAAAGTATTCAAGTCATCGAAGAAACCGTT
CAAGAAGACGAAGGACGATGTCGCTGCAAGGTCTGAAGCCATGGCTCTCCAGCTCGAAGACGTTCCTGACTTTCCTCGAG
GGGGAGGCACTTCTCTGAGCAAAACAGAGCGTAAGAAAATATATGAAGAGGTCGACGCTGAGTTTGAAGCTGAGGAGCGT
GTTTCCAAGAGGAGTAAAGGAGGTAAACCTAAGATGAAGAGAAACCCTAGCGAGGTTGACGAATTAGGATCTCTTTTTGA
CGGTGGTTTAACTGGAAAACGGCCAAGATATGCCAATAAGATTACCATTAAGAATATCTCTCCGGGAATGAAGCTTCTTG
GAGTTGTTACTGAAGTAAACCAGAAGGACATAGTAATTAGTCTTCCAGGGGGATTACGTGGACTGGTTCGCGCAAGCGAG
GCCTTGGATTTTACGGATTTCGGAACAGAGGACGATGAAAATGAACTCCTTCGAGACATCTTTTCGGTGGGCCAGCTTGT
TCCTTGCTTTGTATTGCAGTTAGATGATGATAAGAAGGAGGCGGGCAAAAGGAAAATATGGCTTTCGTTGCGACTTTCTT
TGTTGCACAAGGGATTCAGTTTGGATTCCTTTCAGTCGGGAATGGTAGTCACTGCAAGCGTGAAAAGCGTGGAAGATCAT
GGTTATATCCTTCACTTTGGATTGCCTTCTATCACAGGATTTATCAAAAAAAGCAAAGATGGAAATCAAGAGTTAAAGAC
TGGGCAACTTATTCAGGGCGTGGTTACAAATATTGATAAAGAACGGAAAATTGTTTCTCTTAGTGCGGACCCAGATTCAG
TGGCGAAGTGTGTGACCAAGGATCTTAGTGGTATGTCGTTTGATCTTCTCATACCAGGCATGATGGTTAATGCCCGTGTG
CAATCTGTACTTGAGAATGGGATACTGTTAGGATTTCTTATGTACTTTACTGGAACGGTTGATCTATTCCATTTACAAAA
TCCAATGTGTAACAAGAGCTGGAAGGATGAATATACTCAGACTAAGATGGTCAATGCTAGAATATTGTTTATGGATCCAT
CAACTAGAGCTGTTGGTTTGACGTTAAACCCACATCTTGTTGGTAACAAGGTTCCTCCTTTGCATGTCTCTAGCGGAGAC
ATATTTGATGAAGCAAAAGTTGTCCGTGTTGATAAATCAGGCCTTCTTCTTGAACTCCCTTCTAAGCCTGTTTCAACTCC
AGCATATGTTAGCACTTATGACGCAGCAGAAGATGAAGTAAAGAAACTGGAAAAGAATTTCAAGGAAGGAAACCGCATCC
GTGTTCGAATCCTCGGCCTTAAGCATATGGAGGGGTTGGCGATAGGGACTTTAAAGGAAAGTGCTTTTGAAGGGCCAGCT
TTCTCCCACTCAGATGTCAAGCCTGGTATGGTGACGAAGGCAAAAATCATATCTGTTGATACATTTGGTGCCATTGTGCA
ATTTCCGGGTGGTTTGAAAGCAATGTGCCCACTTCAGCATATGTCTGAGTTTGAAGTTACGAAGCCCAGGAAAAAGTTCA
AGGTTGGAGCTGAACTAATATTTCGGGTGCTTGGCTGCAAATCAAAGAGAATAACTGTTACATGCAAGAAAACACTTGTC
AAGTCTAAACTTCCGATTTTGAGTTCTTACGCTGATGCAACTGAAGGATTAGTGACACATGGCTGGATAACAAAGATTGA
AAAGCATGGATGCTTTGTTCGCTTCTATAATGGGGTGCAAGGATTTGTTGCCAGATTTGAACTTGGATTAGAGCCTGGTA
GTGATCCCAGTTCAGTGTTTCATGTCGGGGAGGTTGTCAAATGCAGAGTAACCAGTGCTGTTCATGGTACTCGAAGGATC
AACCTCAGCTTTATGATAAAACCAACAAGTGTTTCTGAAGACGATTCCATCAAGTTAGGTAGTATTGTATCTGGGGTAAT
TGATAGTATAACTCCTCAGGCAGTCACTGTCCATGTTAAATCCAAAGGTTTGCTGAAGGGTACAGTTTCTGCTGAACATT
TAGCTGATCATCATGACCAAGCAAAACTAATGATATCCCTTCTAAGACCTGGATTTGAGCTTGATAAGCTGCTGATAATA
GACATTGACGGCAATAACTTGGCTCTCTCTTCAAAATATTCTCTGATTAAGCTTACTGAAGAGCTTCCTTCGGATATTAG
TCAGCTCCAGCCAAACTCAGTGGTTCATGGTTATGTTTGTAACTTGATTGAAAATGGCTGCTTTGTCCGTTTTCTGGGTC
GGTTGACTGGTTTCGCCCCTAGAAGCAAGGCAATTGACGATCCCAGGGCAGATCTGTCTGAATCCTTCTTTGTTGGACAA
TCGGTTCGGGCTAATATAGTTGATATCAATCAAGAAAAAAGCAGGATAACTCTTTCATTGAAACAGTCATCTTGTGCTTC
TGTAGATGCTTCTTTTATCCAGGAGTACTTCCTTACGGATGAGAAGATCTCGGACCTGCAGTCATCTGATAATACTGAAA
GTGAATGTAGTTGGGTTGAGAAATTCTCTATTGGGAGTTTGGTCAAGGGAACCGTACATGAGCAAAATGACCTTGGTTTG
GTGGTGAATTTTGACAATATTGATAACGTGCTTGGTTTTATACCTCAGTATCATTTGGGCGGAGCTACTTTGGAACACGG
TTCTGTTGTCGAAGCAGTTGTTCTTGATATATCTAGGGCAGAGAGACTAGTTGATTTGTCTTTGCGGCCTGAGCTCATAA
ACAACTCAACCAAAGAGGTGTCCAACAACCAGTCCAAAAAGAAACGTAGAAGAGGTATTTCCAAGGAACTTGAAGTCCAC
CAAAGGGTCAGCGCTGTTGTAGAGATTGTGAAGGAGCAATACCTGATTTTGTCGATTCCAGAACATGGTTACACTATAGG
ATATGCGTCAATATCAGACTATAACACACAGAAGTTACCAGTGAAACAATTTTCAGCTGGACAAAGTGTTGTTGCGTCTG
TGGAGTCTCTGCAAAACTCTTTGACGTCGGGGAGGTTGCTTCTACTTCTTGACTCTGTTTCGGGTATTTCTGATACACCC
CATTCGAAGAGGACAAGGAATAAATCCAGTTGTGGGGTTGGTTCTGTTGTCCACGCCGAGATTACTGAAATAAAGCCTTT
GGAAGTAAGAGTAAACTTTGGCCAAAGTTTCCGAGGAAGAATCCACATAACGGAGGTGGATGATGTAAGTACAAGTGAAG
AACCTTTTTCCAAATTCAGAGTCGGGCAATCAGTGTCTGCAAGGGTTATTGCAAAGCCCTGGCATACTAATATCAAAAAG
AGTCTTTGGGAGCTTTCTTCAAAGCCCGCAATACTTAGAGACTCCAGTGAATTGAATGGCATTCAAGTGAGGGAACAACT
TGAGTTTGTTAATGGAGAGCGTGTCAGGGGATACGTCTACAAAGTGGATAAAGAATGGGTTTGGCTGACAATATCTCGCA
ATGTGACGGCCGGCGTATTCATTTTAGACACTGCATGCGACGCTCAAGAACTTGAGGAGTTCGAGAGGCGTTTTCCCATC
GGTAAAGCTGTTTCAGGCTATGTTTTGACGTACAATAAAGAGAAGAAAACAGCACAGTTGGTTCAGCGTCCACTACTTGA
TATCCAGAAAAGCATTGCCAACGGTGGAGGCTGTAAAACGGATAATCTAGACAATAGTATTCCTGGTGATGATGCTACTC
TATTCATTCATGAAGGAGACATTCTTGGTGGAAGAATTTCTAAGATACTTCCTGGTGTTGGTGGACTTCGTGTGCAAATA
GGTCCTAACGTGTTTGGGAGAGTTCATTTTACTGAAATCAATGATTCATGGGTCTCCAATCCATTAGATGGTTTTCATGA
AGGTCAGTTTGTCAAGTGCAAGGTCTTGGAAATCAGCAATTCTAGTAAAGGGACTTTGCAAATTGAATTGTCGTTACGGA
CATCTCTAGATGGTATGACTTCTGACCAACTCTCAGAAGCTTCAAATAATAATGTCAATATATGCAAACGTTTTGAAAGG
ATTGAAGATCTTTCTCCTGATATGGCCATCCAGGGTTATGTCAAGAATACGATGTCAAAAGGTTGTTTTATTATGCTTTC
AAGGAAACTCGACGCGAAAGTTCTATTGTCAAATTTAAGTGATACTTTTGTCAAGGATCCCGAAAAGGAGTTTCCAGTAG
GGAAACTTGTAACTGGCAGGGTGTTAAATGTCGAGTCGTTATCCAAGCGGGTAGAAGTCACTCTGAAGAAAGGAAATGCG
GGTGGGCAACCAAAATCTGAATCTTATGATTTGAAGCAATTCCATGTTGGAGACGTGATATCAGGGAGCATCAAACGAGT
GGAGCCCTATGGCTTATTCATTACAATAGACAAAACGAGCATGGTTGGATTATGTCATAAATCACAGCTTTCTGATGATC
GTATCGAGGATGTACAAGCCAGATATGAGGCTGGGGAAAGTGTCACCGCAAAGATTTTGAAGTTGGACGAGGAAAAGCAA
CGTATATCGCTTGGGATGAAGAGTTCTTATTTTATGAACGACGATGATGTCAAGGCACAGCCACCTTCTGAAGAAAACGC
TAAGGAAGACAGCATGGAATGTGATCCAATCAATGATTTGAAGTCGGGAGTTCTTGCAGCAGTTGGTAATTTCGGGTTCC
AGGAAACAGGTTCTGAAAGACAGAGTGGAACTTCTCTGGTTCTTGCCCAAGTTGAATCAAGGGCTTCTATCCCTGCGCTT
GAGGTTAACCTTGACGACATTGAGGAAGCGGGATTTGACAATGATCAGAATGAGAAGCTACAGGGAGTCGATAAAGATGA
AAAGAGCAAGAGAAGGGAAAAGCAGAAAGACAAAGAAGAAAGAGAGAGAAAAATACAAGCTGCTGAAGGAAGATTGCTGG
AGAATCATGCTCCTGAGAGTGCTGATGAATTCGAGAAATTGGTTAGAAGCTCTCCAAATAGCAGCTTTGTCTGGATTAAG
TATATGGCGTTCATGCTCAGTTTGGCTGATATTGAGAAAGCCAGGTCCATCGCTGAGAGGGCCTTGAGGACTATAAATAT
TCGTGAAGAAGATGAGAAGCTAAACATATGGGTTGCTTACTTCAATTTGGAAAATGAACATGGAAGTCCTCCAGAGGAAG
CTGTTAAGAAAGTTTTTGAAAGAGCACGTCAATACTGTGACCCAAAGAAAGTTTACCACGCTCTCTTGGGCGTATACGAG
AGAACAGAGCAATATAAATTGGCTGATAAGCTGCTTGATGAGATGGTCAAGAAGTTCAAGCAATCTTGCAAGGTTTGGTT
AAGAAAAGTACAAAGTCATCTGAAGCAAGACGTGGAAGACATTCAGTCCATCGTGAATCGTGCCTTGCTATGTCTTCCGC
GCCATAAGCACATTAAATTCATATCACAGACAGCTATTCTTGAGTTCAAATGCGGAAATGCAGACAGAGGGAGATCACTT
TTTGAAGGCGTTCTTAGGGAATACCCAAAGAGAACAGACTTGTGGAGTGTTTATCTTGACCAGGAGATTCGGTTGGGAGA
AGTTGATGTGATTAGATCTTTGTTCGAGAGAGCCATTAGCTTGAGTTTGCCTCCTAAGAAGATGAAGTTTTTATTCAAGA
AGTTCTTGGAATATGAGAAATCTGCTGGTGACGAGGAGAGAGTCGAGTACGTGAAGCAAAGGGCAATGGAGTATGCAGAC
AGTACCTTGGCCTGA