Details for Kale Locus Bo5g134950

Position : C5 ( 5`- 41921790 .. 41924156 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134950

Protein [Map View]
MEALFLSSSSSSIAAPNKLFRRDWCTLVTDKKRLGLTWCRVGGGGGDGRNIKPERPLRVSSLLKDRGQVLIREQSSPAVD
ADTLVVSPNGNERAIEINGVKTLMPFSGAAKVGSKEGLGIVSFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVGKIYLLI
KAKNKEAAIARLKSEVLDTELFKTLRETHGASYQSFMLDKLVPVTGNICDSNIGLQIDSAEEIAKEVDVIINSAANTTFN
ERYDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATENFLEGNRKALDVDREMKLAL
DAARKGTQDQEKAQKMKDLGLERARSYGWQDTYVFTKAMGEMMINSTRGDVPVVIIRPSVIESTYKDPFPGWMEGNRMMD
PIVLCYGKGQLTGFLVDPKGVLDVVPADMVVNATLAAIAKHGVAKTDQEPEINVYQIASSAINPLVFENLAELLYNHYKS
TPCMDSKGVPIMVPLMKLFDSVDDFSDHLWKDAQERSGLMNGVSLADSKMLQKLKFICKKSVEQAKHLATIYEPYTFYGG
RFDNSNTQRLLEYMSEAEKNEFGFDVGNINWKDYITNVHIPGLRKHVLKGRA*

DNA
ATGGAAGCTCTCTTCTTGAGTTCTTCTTCTTCCTCCATCGCTGCACCAAACAAGCTTTTCCGTCGTGACTGGTGTACGTT
GGTTACTGATAAGAAAAGGCTAGGCCTCACCTGGTGCCGCGTTGGTGGTGGAGGTGGTGATGGGAGAAACATCAAACCAG
AGAGGCCTCTTCGGGTTTCTTCTCTTTTGAAAGACAGAGGTCAAGTGCTAATAAGGGAGCAGAGTTCACCAGCTGTGGAT
GCTGACACATTGGTTGTGTCTCCAAACGGGAATGAGAGAGCCATTGAGATCAATGGAGTAAAGACTTTGATGCCTTTTAG
TGGCGCTGCTAAGGTGGGGAGCAAAGAAGGACTTGGCATTGTCAGTTTCCTCCAAGGGAAGAAGTTTTTGATCACTGGCT
CAACTGGTTTCTTAGCTAAGGTACTGATTGAGAAGGTCTTGAGAATGGCTCCGGATGTTGGGAAGATATATCTCTTGATT
AAAGCCAAAAACAAAGAAGCTGCTATTGCGAGGTTAAAGAGCGAGGTGTTGGATACGGAGCTTTTTAAGACTCTAAGAGA
GACTCATGGAGCATCTTATCAGTCTTTCATGTTAGACAAGCTAGTTCCTGTGACGGGGAACATATGTGATTCAAACATTG
GGTTGCAAATAGATTCAGCTGAGGAGATTGCAAAAGAAGTTGATGTGATTATCAACTCTGCTGCCAATACAACCTTCAAT
GAAAGATATGATGTTGCTTTGGACATAAACACACGAGGGCCTGGTAATCTCATGGGATTCGCCAAGAAGTGCAAGAAACT
CAAGCTTTTCTTGCAAGTATCCACAGCTTATGTGAATGGACAAAGACAAGGAAGGATCATGGAGAAGCCATTCTCAATGG
GAGATTGTATAGCAACCGAGAACTTCCTTGAAGGAAACAGGAAAGCATTAGATGTCGATAGAGAGATGAAGCTAGCTCTT
GATGCTGCAAGAAAAGGGACTCAAGATCAAGAGAAGGCTCAGAAGATGAAAGATCTCGGTCTAGAAAGGGCAAGATCATA
TGGATGGCAAGACACTTATGTTTTCACTAAAGCAATGGGAGAAATGATGATCAATAGCACTAGAGGGGACGTACCTGTGG
TTATTATAAGGCCTAGCGTTATAGAAAGCACTTACAAAGACCCTTTCCCTGGTTGGATGGAAGGAAACAGGATGATGGAT
CCTATAGTACTATGTTATGGAAAAGGACAGCTGACCGGGTTCTTGGTGGATCCGAAAGGAGTTCTTGATGTGGTTCCTGC
TGATATGGTCGTTAACGCGACATTAGCTGCTATTGCTAAGCATGGAGTGGCGAAGACAGATCAAGAACCTGAAATAAACG
TGTATCAGATCGCTTCTTCTGCGATAAACCCGCTTGTTTTCGAGAACTTAGCAGAGCTTCTTTATAACCACTACAAATCT
ACACCGTGCATGGACTCCAAAGGTGTTCCTATCATGGTGCCTTTGATGAAACTTTTCGATTCCGTTGATGATTTCTCGGA
TCATTTGTGGAAAGATGCTCAAGAACGGAGCGGTTTAATGAATGGTGTGAGCCTAGCGGATAGTAAGATGTTGCAGAAGT
TAAAGTTTATATGCAAAAAGTCTGTTGAACAAGCTAAACACCTTGCCACTATCTATGAGCCGTACACTTTCTATGGTGGA
AGATTTGATAATAGTAATACACAGAGGTTACTGGAATATATGTCAGAAGCAGAGAAGAATGAGTTTGGGTTTGACGTTGG
AAACATTAACTGGAAGGATTACATTACAAATGTTCACATTCCCGGTTTAAGAAAACATGTCTTGAAGGGAAGAGCTTAA