Details for Kale Locus Bo5g134830

Position : C5 ( 5`- 41876690 .. 41878290 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134830

Protein [Map View]
MATSFKKTQTTEDPTVEIQIPSAKRLCLGIARDVILERRPATQVTQAIDVLALNAIKKLQYRNPFFPLEDNERHSPSGSS
IDEEVEMNLPSDSNENMFCADEQQGSQLSSPAISPDELYKFVFASVEEMMVDESDYLVAIVTEFLRSISAGKLKVDLNIY
VMTIRLLIIEPSKEVALQLLESGRQNPRVRKLGLDMLRQLSLYHDYISSLVQDGYYLEALRYAQKHKVTSVRSSLVLEAA
FASNDMQHLAAILRVLLELIPGFKETAEYYT*

DNA
ATGGCGACCAGCTTCAAGAAAACCCAGACAACAGAAGATCCAACCGTTGAAATCCAAATCCCTTCGGCCAAACGACTGTG
CTTAGGGATAGCAAGGGATGTTATTTTGGAGCGGAGACCAGCAACCCAGGTCACGCAGGCAATAGATGTACTGGCATTGA
ATGCTATAAAGAAGTTGCAGTATCGTAACCCATTTTTCCCTCTTGAAGATAACGAAAGGCACAGTCCATCTGGAAGCAGT
ATTGATGAAGAAGTTGAAATGAACCTACCATCTGATTCAAATGAGAACATGTTTTGTGCTGACGAGCAGCAGGGATCTCA
ACTTTCGTCACCAGCCATTTCACCTGATGAGCTCTACAAGTTTGTGTTTGCTTCTGTGGAGGAAATGATGGTTGATGAAT
CTGACTATCTAGTTGCTATCGTAACTGAGTTCCTTCGCAGTATAAGCGCAGGGAAACTCAAAGTGGATCTCAACATTTAT
GTGATGACCATCAGACTGTTAATAATCGAACCATCAAAGGAAGTCGCGCTCCAACTTCTCGAGAGCGGTCGCCAAAACCC
GAGGGTAAGGAAACTTGGACTTGATATGCTGAGACAGCTCTCGTTGTACCATGACTACATCTCCTCACTCGTGCAAGATG
GATACTATCTTGAAGCTCTGCGTTATGCTCAGAAGCATAAGGTGACGAGTGTGCGATCTTCGCTGGTTTTGGAAGCAGCA
TTTGCGTCTAATGATATGCAGCATTTGGCTGCAATATTGAGGGTCTTGTTGGAATTGATTCCAGGATTTAAAGAAACTGC
CGAATATTACACATGA