Details for Kale Locus Bo5g134800

Position : C5 ( 5`- 41863547 .. 41864949 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134800

Protein [Map View]
MKTPPRGSKRVDQESDLPKVTTPVALRAAREKKHCSKARAVRVRPEYPLTRISPEMKLMPPEFFQIDALDLAPRLLGKFL
RRDDVVLRITEVEAYRPNDSACHGRSGVTPRTAPIFGPGGHAYVYLCYGLHMMLNIVADKDGVGAAVLIRSCSPVTGLET
IQERRGQKIDKPLLLNGPGKVGQALGLSTQWSHHPLYSPGGLEVLDGGEDVEKVLVGPRVGIDYALPEHVNALWRFAIAN
TPWISAPKNTLKPLTSTHSS*

DNA
ATGAAAACGCCGCCTCGTGGATCGAAGCGGGTTGATCAGGAATCGGATCTACCCAAGGTTACAACTCCAGTGGCTCTACG
TGCAGCACGAGAGAAGAAGCACTGTTCCAAGGCTCGGGCGGTTCGGGTCAGACCCGAGTACCCACTGACCCGCATTTCCC
CCGAGATGAAGCTTATGCCTCCTGAGTTCTTTCAAATCGACGCGCTTGATCTAGCTCCGCGTCTGCTCGGGAAGTTCCTG
AGGAGAGACGATGTTGTCCTACGGATCACAGAGGTAGAAGCTTATAGACCAAATGACTCAGCTTGCCATGGACGTTCCGG
GGTTACCCCACGGACCGCACCTATTTTTGGACCAGGAGGACATGCCTATGTTTATCTTTGTTACGGTCTTCATATGATGC
TCAATATTGTTGCTGATAAGGATGGAGTTGGAGCCGCTGTTTTGATACGGTCTTGTTCTCCTGTTACCGGGCTGGAGACC
ATACAGGAGCGCCGTGGCCAGAAAATCGACAAACCCCTTCTTTTAAATGGACCAGGAAAGGTGGGGCAAGCGCTTGGACT
TTCAACACAGTGGTCTCATCATCCCCTCTATTCTCCTGGAGGATTGGAGGTTCTGGATGGAGGAGAAGATGTGGAGAAAG
TATTGGTTGGTCCTCGAGTCGGGATAGATTATGCATTGCCTGAACATGTCAATGCCTTGTGGAGATTTGCCATTGCAAAC
ACTCCATGGATAAGTGCTCCTAAGAACACTCTTAAGCCTCTAACTTCAACCCACAGCTCTTAG