Details for Kale Locus Bo5g134790

Position : C5 ( 5`- 41860923 .. 41862633 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134790

Protein [Map View]
MAKFGEGDKRWIVEDRPDGTNVHNWHWAETNCLEWSRNFFNNQFSDAVILSGEGNLFIKIKKVEKLEGEAYVNVRKGKII
PGYELSVSLSWEGEAKDSEGKTISKAEGSVDMPYISDENADEDPEVRVSVKDEGAVGKTLKEAMVKKGKGVVLEKVRVFV
EAMARGGPCRDELENKKVAPKSAPAAATVEKTSTLPAVVVKEKKKVKTKEGFKTITMTEKFSCRAKDLYEILMDENRWKG
FTQSNAKISKDVNGPISVFDGSVTGMNVELEEGKLIVQKWRFGSWPDGLDSTVKIAFEEPEPGVTIVNLTHTDVPEEDRY
GNATVVENTERGWRDLIFHRIRAVFGFGM*

DNA
ATGGCGAAGTTCGGCGAAGGCGACAAGCGATGGATCGTCGAAGACCGTCCCGACGGCACCAACGTCCACAACTGGCACTG
GGCCGAAACCAACTGCCTCGAATGGTCCCGCAACTTCTTCAACAACCAATTCTCCGACGCCGTCATCCTCTCCGGCGAAG
GCAACCTCTTCATCAAAATCAAGAAAGTGGAGAAGCTCGAAGGCGAGGCGTACGTGAACGTGCGCAAGGGGAAGATCATC
CCCGGCTACGAGCTCAGCGTCTCTCTTTCCTGGGAAGGCGAGGCGAAGGATTCGGAAGGGAAGACGATCTCGAAGGCGGA
GGGGTCGGTGGATATGCCGTATATCTCCGATGAGAATGCGGATGAGGATCCGGAGGTTAGGGTTTCGGTTAAGGACGAGG
GGGCGGTTGGGAAGACGCTGAAGGAGGCGATGGTGAAGAAGGGGAAGGGGGTTGTTTTGGAGAAGGTTAGGGTTTTTGTG
GAGGCTATGGCGAGAGGAGGGCCGTGTAGGGATGAATTGGAGAATAAGAAGGTGGCTCCTAAGTCAGCTCCGGCGGCGGC
AACTGTGGAGAAGACTAGTACTTTGCCTGCTGTGGTGGTGAAAGAGAAGAAGAAGGTGAAGACAAAGGAAGGGTTCAAGA
CGATTACTATGACTGAGAAGTTTAGTTGTAGAGCTAAGGACTTGTATGAGATCTTGATGGATGAGAACCGTTGGAAAGGA
TTCACGCAGAGCAATGCTAAGATTAGTAAAGATGTGAATGGGCCCATTAGTGTTTTTGATGGTTCGGTTACTGGGATGAA
TGTGGAGCTTGAGGAAGGAAAGTTGATTGTGCAGAAGTGGAGGTTTGGGAGCTGGCCTGATGGTCTTGATTCAACGGTGA
AGATAGCTTTTGAGGAACCTGAACCAGGAGTCACCATTGTCAATCTTACTCATACCGACGTTCCTGAAGAAGACAGGTAC
GGGAATGCAACTGTGGTGGAAAACACGGAGAGAGGATGGAGAGACCTGATCTTCCATAGGATCCGTGCTGTTTTCGGGTT
TGGAATGTGA