Details for Kale Locus Bo5g134780

Position : C5 ( 5`- 41856307 .. 41858456 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134780

Protein [Map View]
MTSESVKHMPIHGGTTISAASFELKGFLSAAKPRKASTFVYAFVITFVAFTVLLVFTPSPITVSHSIPSYILPNVTASTT
LPAPAPENLTPAIKNATFESPIGNGTNSLASDSRSDHAWENMLSPDNKTGDTSRSSDKQLPAETPLFKDPAVNSSAFKKR
KQRRKSWMRREIKSLKNCEFYEGEWVKDDSYPLYKPGSCNLIDEQFTCISNGRPDAEFQKLKWKPKQCTLPRLNGGKLLE
MIRGRRLAFVGDSLNRNMWESLVCILKGSVKDKSQVFEAHGRHQFRWEAEYSFVFKDYNCTVEFFASPFLVQEWEVSDKN
GTKKETLRLDVVGKSSEQYKGADILVFNTGHWWTHDKTSKGEDYYQEGSNVHPKLDVDEAFRKALTTWGQWVDENVNPKK
SLVFFRGYSPSHFSGGQWNAGGACDDETEPIKNETYLTPYPSKMLILERVLKGMKSPVTYLNITRLTDYRKDAHPSVYRK
HKLSAKERKSPLLYQDCSHWCLPGVPDSWNEILYAEMLVKLHQLRGNRRRKPKGL*

DNA
ATGACTTCAGAGTCTGTCAAGCATATGCCTATCCACGGCGGAACAACCATCTCCGCCGCATCCTTCGAATTAAAAGGCTT
TCTCTCAGCCGCGAAACCAAGAAAAGCCTCGACTTTTGTATACGCCTTCGTCATAACCTTTGTTGCCTTCACTGTTCTCT
TAGTCTTCACACCTTCTCCCATCACTGTCTCTCATTCCATTCCTTCATACATTCTCCCTAATGTCACTGCCTCCACCACA
TTGCCAGCACCCGCGCCGGAAAATCTCACTCCGGCTATTAAAAACGCAACCTTTGAGTCTCCCATCGGTAATGGAACAAA
TTCACTTGCTTCTGACTCCCGGAGCGACCATGCATGGGAGAACATGTTGTCTCCCGACAATAAGACTGGTGATACTTCTC
GAAGTTCCGACAAACAACTACCCGCGGAAACTCCTCTGTTTAAGGATCCAGCAGTCAATTCCTCTGCTTTTAAGAAGAGA
AAACAGAGGAGGAAGTCGTGGATGAGACGAGAGATAAAGTCTTTAAAGAACTGCGAGTTTTACGAGGGAGAGTGGGTGAA
AGACGACTCGTATCCTCTCTACAAACCCGGTTCGTGTAATCTGATCGACGAGCAGTTTACTTGTATCTCCAACGGGAGAC
CTGACGCTGAGTTTCAGAAATTGAAGTGGAAGCCAAAGCAATGCACTTTACCAAGGTTGAATGGAGGCAAATTGCTGGAG
ATGATTAGAGGAAGAAGACTCGCGTTTGTTGGAGATTCACTGAATAGGAACATGTGGGAGTCTTTGGTTTGTATTCTCAA
AGGATCAGTGAAAGATAAGAGTCAAGTCTTTGAAGCTCATGGACGGCATCAGTTCCGTTGGGAGGCTGAGTACTCGTTCG
TCTTCAAAGATTATAATTGCACTGTGGAGTTCTTTGCATCACCTTTCTTGGTTCAAGAATGGGAAGTTTCCGACAAGAAC
GGGACTAAGAAGGAGACTCTGAGGTTAGATGTGGTAGGGAAGTCGTCTGAGCAGTACAAAGGAGCTGATATTCTAGTATT
CAATACTGGACATTGGTGGACTCATGACAAAACTTCCAAAGGGGAGGATTATTATCAAGAAGGAAGCAATGTACACCCGA
AACTCGACGTGGATGAAGCTTTTAGGAAAGCATTAACGACTTGGGGTCAATGGGTTGATGAGAATGTCAATCCAAAGAAG
TCTCTTGTCTTCTTCCGTGGATATTCACCTTCACATTTCAGTGGAGGGCAATGGAATGCGGGAGGGGCTTGCGATGATGA
AACAGAACCGATCAAGAACGAGACATACCTAACGCCTTACCCTTCTAAAATGTTAATACTTGAAAGAGTTCTAAAGGGGA
TGAAATCTCCGGTCACGTATCTCAACATCACAAGGCTAACAGATTACAGAAAGGACGCTCACCCATCTGTTTATAGGAAA
CATAAACTATCTGCAAAAGAAAGGAAATCACCATTGTTGTACCAAGACTGTAGTCACTGGTGCCTCCCAGGTGTGCCTGA
TTCTTGGAACGAGATTCTCTATGCTGAGATGCTTGTAAAGCTCCACCAGCTTCGGGGCAACAGACGGCGGAAACCTAAAG
GTTTATAG