Details for Kale Locus Bo5g134770

Position : C5 ( 5`- 41850221 .. 41853529 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134770

Protein [Map View]
MASLLDSLTTRNFFSKPIISRISSPSSSFASSSSSNISPFSPPSVLSYSHKRSHHSRLPYPVAATLDGPSVEEDELEFEE
SEEDSYPDESDEEEDISIDISILEKEARDIARDYATTLSRELKLEDDVVEGKESRRKGKRQAKNNQAQILEHLLQRVAIV
GRPNVGKSALFNRLVGENKAIVVDEPGVTRDRLYGRSYWGDQEFVVVDTGGVMTVSKSPAGVMEELNVSTTIGMEGIPLS
SREAAVARMPSMIEKQATAAVEESDVIVFVVDGQTGPTGADVEIADWLRKYYSHKNIILAVNKCESPRKGLMQASEFWSL
GFSPIPISALSGTGTGELLDLVCSGLNKLEIMETMEEEEEENYIPAIAIIGRPNVGKSSILNALVREDRTIVSPVSGTTR
DAIDAEFTGPDGEKFRLIDTAGIRKKAAVASSGSTTEAMSVNRAFRAIRRSDVVALVIEAMACITEQDMKIAERIEREGK
GCLVVVNKWDTIPNKNQQTAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTATLNQVIREA
VAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLRTDAGFAGTPIRLLWRSRKRSDKNGGGG
GTMRMSSLSRERNLATKRS*

DNA
ATGGCGAGTCTACTTGACTCACTCACAACCAGAAACTTCTTCTCTAAACCCATAATCTCTAGGATCTCTTCTCCTTCATC
TTCCTTTGCTTCTTCTTCTTCTTCGAATATCTCACCCTTTTCTCCTCCCTCCGTTCTCTCTTACTCTCACAAAAGGTCGC
ATCATTCCCGCCTCCCTTACCCTGTCGCAGCAACTCTCGATGGTCCCTCCGTTGAAGAAGACGAGCTAGAGTTCGAGGAA
TCCGAAGAAGACAGCTACCCTGATGAGTCGGATGAAGAAGAAGACATCTCCATCGATATCTCAATTCTTGAAAAGGAAGC
GAGAGATATCGCTAGGGATTACGCTACTACACTGTCTCGCGAGCTCAAACTCGAGGATGATGTAGTTGAAGGGAAGGAGT
CACGTAGAAAGGGGAAGAGGCAAGCCAAAAATAACCAGGCGCAGATACTAGAGCATCTTCTCCAAAGAGTTGCTATCGTT
GGAAGGCCCAATGTGGGCAAATCAGCATTGTTCAACCGTCTCGTTGGGGAGAATAAAGCGATAGTGGTGGATGAACCTGG
AGTTACTAGGGATAGACTGTACGGTAGATCCTACTGGGGCGATCAAGAGTTTGTGGTGGTGGACACAGGAGGTGTCATGA
CTGTTTCCAAGTCGCCAGCTGGTGTCATGGAAGAGCTTAACGTTTCGACCACCATTGGCATGGAAGGTATTCCACTAAGC
TCTAGGGAGGCAGCTGTTGCGAGGATGCCTTCCATGATTGAGAAGCAAGCTACTGCGGCTGTGGAAGAGTCAGATGTTAT
TGTTTTCGTTGTCGATGGCCAGACAGGGCCTACAGGTGCTGATGTGGAGATTGCAGACTGGTTGCGGAAGTACTATTCAC
ATAAGAATATCATCCTCGCGGTGAACAAATGTGAATCGCCACGTAAAGGACTCATGCAGGCTTCAGAGTTTTGGTCTCTT
GGGTTTTCACCTATCCCTATTTCCGCATTGTCGGGAACTGGAACAGGAGAGCTACTTGATCTTGTTTGTTCTGGACTAAA
CAAACTCGAGATAATGGAGACCATGGAAGAGGAGGAAGAAGAAAACTACATACCTGCCATTGCAATTATAGGCAGGCCAA
ATGTTGGGAAAAGCAGCATTTTGAATGCACTTGTCCGAGAGGATAGAACAATTGTTAGCCCTGTTAGTGGCACTACCCGT
GATGCTATTGATGCTGAATTTACCGGACCAGATGGGGAGAAGTTTAGGCTTATAGATACGGCTGGGATCAGGAAAAAAGC
TGCTGTGGCTTCATCAGGGAGCACTACAGAGGCCATGTCAGTGAACCGTGCATTCCGAGCAATTCGTCGCTCTGATGTGG
TTGCTCTTGTCATTGAAGCCATGGCATGCATAACAGAGCAGGACATGAAGATTGCAGAAAGAATCGAAAGAGAAGGGAAA
GGATGTCTTGTAGTTGTAAACAAATGGGATACAATACCAAACAAAAACCAACAGACTGCAGCACATTACGAGGATGATGT
CAGGGAGAAGCTCCGTTCCCTCAAATGGGCACCCATTGTTTATTCAACTGCTATTACTGGCCATAGCGTTGACAACATTG
TGGTTGCTGCTGCGACGGTTCAAAAGGAGAGATCAAGAAGACTTAGTACAGCTACATTGAACCAAGTGATAAGAGAAGCG
GTTGCGTTTAAATCCCCTCCAAGAACCCGAGGAGGCAAACGAGGCCGTGTTTATTATTGCACTCAGGCAGCAATAAGGCC
ACCGACGTTTGTGTTCTTTGTAAACGATGCAAAGCTGTTTTCGGATACGTACAGAAGATATATGGAGAAGCAGCTACGCA
CAGATGCAGGCTTTGCTGGGACTCCTATTCGTCTTCTTTGGCGCAGCCGTAAGAGATCTGACAAAAATGGAGGAGGTGGA
GGAACAATGAGAATGTCAAGTCTTTCACGTGAGAGAAATCTTGCAACCAAACGGTCATAA