Details for Kale Locus Bo5g134760

Position : C5 ( 5`- 41848363 .. 41849685 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134760

Protein [Map View]
MYRFSNTVIGVLNLLSLLASIPIIGAALWKARSSTTCENFLQTPLLVIGFIILLVSLAGFIGACFNVAWALWVYLVVMIF
LIATLMGLTLFGLVVTSQGGGVEVPGRVYKEYRLGDYHPWLRERVRDPQYWISIRSCILSSKTCAKIESWTTLDYFQRDM
TSVQSGCCKPPTACAYETGVIVGGEDCYRWNNGIETLCYECDACKAGVLEEIRLDWRKLSVVNILVLVLLIAVYAAGCCA
FHNTRHAAHPYHPSDDNRMTKVRPRWDYYWWRWWHEKKEQLY*

DNA
ATGTACAGATTCAGCAACACAGTGATTGGAGTCTTAAACCTCCTCAGCTTACTAGCTTCAATACCAATCATAGGAGCCGC
TCTATGGAAGGCAAGAAGCAGCACAACTTGCGAAAACTTCCTCCAGACTCCTCTACTCGTTATAGGTTTCATCATACTCT
TAGTATCTCTCGCCGGATTCATAGGAGCCTGTTTCAACGTGGCATGGGCTCTTTGGGTTTACTTAGTGGTCATGATCTTC
CTCATCGCGACTCTTATGGGTCTAACTCTGTTTGGTCTGGTGGTGACGAGCCAAGGAGGCGGTGTGGAAGTACCAGGGAG
GGTTTATAAAGAGTATAGGCTTGGTGATTATCATCCATGGTTGAGAGAGAGAGTTAGAGATCCTCAGTATTGGATCTCTA
TAAGAAGCTGTATCTTGAGTTCCAAGACTTGTGCTAAGATTGAATCTTGGACTACACTTGATTATTTCCAAAGAGACATG
ACTTCTGTTCAGTCGGGATGTTGTAAGCCACCAACGGCGTGCGCGTACGAGACCGGAGTAATAGTAGGAGGAGAAGATTG
CTATAGATGGAACAATGGTATTGAAACGTTATGCTACGAGTGTGATGCTTGCAAAGCTGGTGTTCTTGAAGAGATACGTC
TTGACTGGAGAAAGTTATCGGTCGTTAATATTCTGGTCCTTGTCCTCCTCATCGCTGTCTATGCTGCTGGTTGCTGCGCC
TTCCACAACACTCGCCACGCAGCTCATCCTTATCATCCTTCTGATGATAACCGCATGACCAAAGTCCGTCCTCGTTGGGA
CTATTACTGGTGGAGATGGTGGCATGAAAAGAAAGAACAGCTTTACTGA