Details for Kale Locus Bo5g134750

Position : C5 ( 5`- 41844193 .. 41847115 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134750

Protein [Map View]
MERSVSFDLSGDNELPNDRSSDVGYTANDRRLAYSRSFHHSHSHGPRTPAAKPFLDRTVSTIDMPPEIYSVDGDDVFFGE
GKAAAIGKASALRMVLVVFGVLRNGNRQMKRLFLLISLNVAYSTTELLIGLLTGRVGLVSDAFHLTFGCGLLTFSLFAMA
TSRKKPDHAYSYGYKRLEVLSAFTNALFLMFMSFSLAVEALHAFVQDESEHKHYLIVSAVTNLLVNLLGVWFFRNYARMN
IVYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLGVENAEVLCLGLVSVTVFMLVMPLFKATGGVLLQMAPPNIPSS
ALSKCLRQITSREDVIEVLQARFWEVVPGHTVGSLRIQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTDYS*

DNA
ATGGAGAGATCCGTTTCCTTCGATCTTAGCGGCGATAACGAACTCCCGAATGATCGGAGCAGCGACGTCGGATACACCGC
CAATGATCGGAGGCTCGCTTACTCCCGCTCCTTTCACCACTCCCACTCCCACGGCCCGCGAACGCCCGCAGCTAAGCCTT
TTCTCGATAGGACGGTCTCCACCATCGATATGCCGCCGGAGATATACTCTGTCGACGGGGATGATGTTTTCTTCGGGGAA
GGGAAAGCGGCGGCGATTGGGAAAGCGTCGGCTTTGCGTATGGTTTTGGTGGTTTTTGGGGTGCTGAGAAATGGAAATCG
GCAGATGAAGAGATTGTTTCTGCTGATTTCGCTTAACGTGGCGTATTCTACCACAGAGCTGTTGATTGGGTTATTGACTG
GGCGTGTAGGTTTGGTTTCCGATGCATTCCATTTGACATTTGGATGTGGTCTCTTGACGTTTTCTTTGTTTGCAATGGCG
ACTTCAAGGAAGAAGCCTGATCATGCTTACTCGTACGGGTACAAAAGACTTGAAGTTCTATCTGCTTTCACTAATGCTCT
GTTTCTTATGTTCATGTCGTTCTCCTTAGCTGTGGAAGCTCTTCATGCATTTGTTCAAGATGAATCAGAGCACAAGCATT
ATCTTATTGTATCAGCGGTAACAAATCTGCTGGTGAACCTACTTGGTGTTTGGTTCTTCCGGAATTATGCTCGTATGAAT
ATTGTGTACAGAAAAGCAGAAGATATGAACTACCACTCCGTTTGCTTGCATGTCATATCAGATTCCATCCGCAGTGCAGG
TCTGATACTGGCATCCTGGCTCCTCTCTCTGGGGGTTGAAAATGCAGAGGTCCTATGTTTGGGATTGGTATCAGTTACAG
TGTTTATGCTTGTTATGCCACTCTTCAAAGCCACTGGTGGCGTTTTGCTTCAGATGGCACCTCCAAACATTCCTTCTTCC
GCATTAAGTAAATGCTTGCGTCAGATTACTTCTCGAGAGGATGTCATAGAGGTTTTACAGGCACGTTTCTGGGAGGTTGT
GCCCGGTCACACTGTTGGCTCACTCAGAATCCAGGTGAAGAGCGGGATAGATGAAAGGCCTTTACTGCAATATGTGTATG
ATGTATACCATGATTTGGGTGTACAAGACTTGACGCTGCAAACAGACTACAGCTGA