Details for Kale Locus Bo5g134720

Position : C5 ( 5`- 41825207 .. 41827150 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g134720

Protein [Map View]
MDARKRGRPEAGSFNSNGGGFKKSKQEMESGLGSKSKPCTKFFSTSGCPFGENCHFLHFVPGGYNPMAQITNMGSPMSQV
SRNMQGGGGGGGGGGRFSGRGESGPGHVSSFGASATAKISVDASLAGAIIGKGGVCSKQICRQTGAKLSIQDHERDPNLK
NIELEGTFEQINEASAMVRELIGRLNSASRRPPGGGGLGSEGKPHPGSNFKTKMCERFSKGSCTFGDRCHFAHGEAELRR
S*

DNA
ATGGATGCTCGTAAGAGAGGACGGCCTGAAGCTGGCTCATTCAACTCCAATGGCGGTGGATTCAAGAAGTCGAAGCAAGA
GATGGAATCTGGTTTAGGAAGCAAATCGAAGCCATGCACAAAATTTTTCAGCACTTCTGGCTGTCCTTTTGGTGAGAACT
GCCATTTCTTGCACTTTGTTCCCGGAGGATACAATCCTATGGCACAGATAACAAACATGGGATCACCCATGTCTCAAGTT
TCCAGAAACATGCAAGGTGGTGGTGGTGGTGGTGGTGGTGGGGGCCGATTTTCGGGGAGAGGAGAGTCTGGACCTGGCCA
CGTCTCTAGCTTTGGTGCCTCAGCCACAGCCAAAATCAGTGTGGATGCTTCCTTGGCAGGCGCAATCATTGGAAAAGGTG
GAGTCTGTTCGAAACAGATATGTCGTCAAACAGGAGCAAAGCTATCGATCCAAGACCACGAGAGAGATCCCAACCTGAAG
AACATTGAGCTTGAAGGAACATTCGAGCAGATCAACGAAGCGAGCGCAATGGTTAGAGAGCTGATTGGGAGGCTTAATTC
TGCATCTAGGAGACCACCTGGTGGCGGTGGACTTGGTTCAGAAGGGAAACCGCATCCAGGGAGCAACTTCAAAACGAAGA
TGTGTGAGAGATTCTCGAAAGGAAGTTGTACATTTGGTGATAGATGTCACTTTGCACACGGGGAAGCAGAGCTACGCAGG
TCATGA