Details for Kale Locus Bo5g133630

Position : C5 ( 5`- 41776752 .. 41778091 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133630

Protein [Map View]
MKLLLCLSMLFISSLPSSYSCNSKDENTLLQIKKHFNNPDLLSTWSPATDCCTSWTGIECTNGRVTLLSMSKDNNLVGHI
PDQIGDLLELQSLEMSYMNLTGNIPRTITKLKHLDFIFLKWNRLSGPIPDYISELKNVTFMDLSYNKFTGPVPGWLTQMP
KLQTFQIDNNSLTGPIPNSFGSFADSVPNLFLKNNKLSGKIPESLSKIDFQAVVLAGNSFTGDGSMFFGGNKRTVQVDLS
RNKFEFDLSKVKFGKSMALLDLSHNRIFGKLPRELTELPLQRFNISYNRLCGKIPRGGKLQTFKSYEFAHNRCLCGSPLK
KAC*

DNA
ATGAAGCTCCTTCTTTGTCTCTCTATGCTCTTCATCTCTTCTCTCCCATCATCATACAGCTGCAACTCAAAAGACGAAAA
CACCCTCCTTCAAATCAAGAAACATTTTAACAACCCCGATCTCCTCTCCACATGGAGCCCTGCAACCGACTGTTGTACTA
GCTGGACCGGCATCGAGTGCACTAACGGCCGCGTCACGTTACTCTCTATGTCCAAAGACAACAACCTCGTCGGTCATATC
CCGGACCAGATAGGCGACCTCCTCGAACTCCAATCACTCGAAATGAGTTACATGAATCTAACCGGAAACATACCACGCAC
CATCACTAAACTCAAGCACCTAGACTTCATCTTCTTAAAGTGGAACAGACTCTCCGGTCCGATTCCTGATTACATCAGCG
AGCTCAAAAACGTAACGTTCATGGACCTCTCCTATAACAAGTTTACCGGTCCTGTTCCCGGTTGGCTTACTCAGATGCCG
AAGCTTCAGACCTTTCAGATCGACAACAATTCGCTAACCGGTCCTATACCGAACTCTTTCGGTTCCTTTGCTGACAGCGT
CCCTAATCTCTTCTTGAAAAACAATAAGCTCTCAGGAAAAATACCGGAGTCGTTGTCAAAGATCGACTTTCAAGCAGTAG
TTCTGGCGGGAAACAGTTTCACAGGAGATGGTTCAATGTTTTTCGGAGGGAACAAAAGAACAGTACAAGTGGATCTATCG
AGAAACAAGTTTGAGTTCGATCTCTCCAAAGTTAAGTTCGGTAAGAGCATGGCTTTGTTGGATCTGAGCCATAACCGAAT
CTTCGGGAAACTTCCTAGGGAGCTGACCGAGCTACCTCTCCAGCGTTTCAACATTAGTTACAATCGTCTCTGCGGAAAAA
TCCCACGTGGTGGTAAACTTCAGACTTTTAAATCATATGAGTTCGCTCACAACCGCTGTCTTTGTGGGTCCCCGCTTAAG
AAGGCTTGTTAA